Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x4DAbpQk024357 for ; Mon, 13 May 2019 12:37:53 +0200 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1hQ89t-0002mU-Pc for rs_out_1@blacksheep.org; Mon, 13 May 2019 11:26:13 +0100 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1hQ89F-0002mJ-2u for rsgb_lf_group@blacksheep.org; Mon, 13 May 2019 11:25:33 +0100 Received: from resqmta-ch2-09v.sys.comcast.net ([2001:558:fe21:29:69:252:207:41]) by relay1.thorcom.net with esmtps (TLSv1.2:DHE-RSA-AES256-GCM-SHA384:256) (Exim 4.92) (envelope-from ) id 1hQ89C-00037w-K1 for rsgb_lf_group@blacksheep.org; Mon, 13 May 2019 11:25:31 +0100 Received: from resomta-ch2-11v.sys.comcast.net ([69.252.207.107]) by resqmta-ch2-09v.sys.comcast.net with ESMTP id Q82ShXQpochoRQ899hpQoA; Mon, 13 May 2019 10:25:27 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=20190202a; t=1557743127; bh=/8kDBvfq1BW6VtVKfGtnBJ0MX1ima1+vDHowsX43t9U=; h=Received:Received:From:Subject:To:Content-Type:Date:Message-ID; b=nx45KlE0Fn5hlPm72pTTwveAwWXxTVSezjh8RzQ8B7Y+AYyOiU0BNlVKE7+90T56W qVWOqUUTTKRPPiwCXKIaxzLciv0JjP4gNPU5bmjmnvoEvykBWx8PfNX86yXbZqctPM FjJaUZ3/aur+usiZdjwrgnljRzWilCq7eWnNmf2KYuixxgL1N4wxl5L6W/zYQ7wx/A hx4XPWT0SZL9pPoEdEZa7NAY8EqgoTFBuNTk7mB6ok32Zb83trz7Atowg/qs9GZBc7 iaBntLjG/Dp4bx0D/a2FPWTJCEifVlNaft8/ZmB/kyMmZCnCDZsNe8yCrjgGeXdxDH yloeEA0atL5MA== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-11v.sys.comcast.net with ESMTPSA id Q897hKP1mkIGxQ898hdA63; Mon, 13 May 2019 10:25:26 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgeduuddrleeggddvkecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddtnecunecujfgurhephffuvfgtgfhffffkjggfsehtqhertddtreejnecuhfhrohhmpedfjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdfuceojhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvtheqnecukfhppeejfedrgedrvdehfedrudegudenucfrrghrrghmpehhvghlohepqfhpthhiphhlvgigleektddqrfevpdhinhgvthepjeefrdegrddvheefrddugedupdhmrghilhhfrhhomhepjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdprhgtphhtthhopehrshhgsggplhhfpghgrhhouhhpsegslhgrtghkshhhvggvphdrohhrghenucevlhhushhtvghrufhiiigvpedt X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" References: <647014609.20190512185229@gmail.com> <1UTJHxKGBU.5KsXW8slJpP@optiplex980-pc> <07fa2e29-f306-1166-b476-893ceed56629@btinternet.com> <08973106.20190513104602@gmail.com> Date: Mon, 13 May 2019 06:25:25 -0400 Message-ID: <1UTJIuBiW3.81zkFLGiWQb@optiplex980-pc> In-Reply-To: <08973106.20190513104602@gmail.com> User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.9 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Chris, Alan At least one mystery solved! Gave me the opportunity to study up on the workings of e mail ... that's a good thing. No shortage of other mysteries here than need solving. Content analysis details: (-0.9 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:41 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) -0.1 DKIM_VALID_EF Message has a valid DKIM or DK signature from envelope-from domain -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily valid -0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from author's domain X-Scan-Signature: 64a43ebf6189d3fbac7adf77f3718769 Subject: Re: LF: Re: Test Jay's e-mail Content-Type: text/plain; charset=utf-8 X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: X-Spam-Status: No, hits=0.0 required=5.0 tests=TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false Content-Transfer-Encoding: 8bit X-MIME-Autoconverted: from quoted-printable to 8bit by klubnl.pl id x4DAbpQk024357 Chris, Alan At least one mystery solved! Gave me the opportunity to study up on the workings of e mail ... that's a good thing. No shortage of other mysteries here than need solving. Jay W1VD ----- Original Message ----- From: Chris Wilson Reply-To: To: Alan Melia Sent: 5/13/2019 5:46:02 AM Subject: Re: LF: Re: Test Jay's e-mail ________________________________________________________________________________ Hello Alan / Jay, Yes, it appears my GMAIL mail has Blacksheep set as the Reply-To: So mea culpa, quite why it got set as such I am not sure, but I do recall some issues with getting GMAIL working with Blacksheep. I have removed the Reply-To: line now so hopefully I haven't broken anything else in the process. Thanks. It's a bit odd though as i just copy pasted the "Write message to" line from Jay's header, for some reason replying from a group folder still parses the Reply-To setting, I would have thought that would be abandoned and treated as a basic straightforward mailto whoever. Mysterious things (to me), mail headers :) Monday, May 13, 2019, 10:19:02 AM, you wrote: > Not surprising Jay!! If you look down the header the "reply to" variable > is set to the blacksheep address. This must be set in Chris's Mail client. > Alan > G3NYK -- Best regards, Chris mailto:dead.fets@gmail.com