Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x4CGNxRk019536 for ; Sun, 12 May 2019 18:24:00 +0200 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1hPrBD-0000mk-MU for rs_out_1@blacksheep.org; Sun, 12 May 2019 17:18:27 +0100 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1hPrB8-0000mb-Q3 for rsgb_lf_group@blacksheep.org; Sun, 12 May 2019 17:18:22 +0100 Received: from resqmta-ch2-06v.sys.comcast.net ([2001:558:fe21:29:69:252:207:38]) by relay1.thorcom.net with esmtps (TLSv1.2:DHE-RSA-AES256-GCM-SHA384:256) (Exim 4.92) (envelope-from ) id 1hPrB4-0001y7-NP for rsgb_lf_group@blacksheep.org; Sun, 12 May 2019 17:18:21 +0100 Received: from resomta-ch2-01v.sys.comcast.net ([69.252.207.97]) by resqmta-ch2-06v.sys.comcast.net with ESMTP id PrAshl3qAAJn5PrB1hxQBP; Sun, 12 May 2019 16:18:15 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=20190202a; t=1557677895; bh=5HLzZys8oxq9HZya8vHCRcn9KZfCk1watnorFzP1Tm0=; h=Received:Received:From:Subject:To:Content-Type:Date:Message-ID; b=3RuvV6rTtGdPV5PffIwt9w6mum3CxfhrKS6lRmMp4lAiEUbgXYgzYuJbrxv4a8y9h HTIOo/Iz9ZTw0pS7QjKNutQ9AqD76IIjlRGZHQ5w1fQgwsCUD+nAVPaZagq960snA6 YuIVxKUkkVcFZjQBp364zyhUQ/60UZzappUzHv8mBpDrYPC4ob511d1cRIjVdDzs/B Pr0/zsmZcPHVbSWiPTm3JXHqZ2sFfZAycXuOXED1yxEaDEn4MKzLUOg4DdoHwkI+Rr O1saO3UZ5kFLMr3O2KORM/m2I40YHC0V6bxATpRdYdJko6s02x8A0ZRQh1NbwiKSRu OYGsAVcqV4IdA== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-01v.sys.comcast.net with ESMTPSA id PrAyhzBeOrgGEPrB0heNMx; Sun, 12 May 2019 16:18:14 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgeduuddrledvgddutdduucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuvehomhgtrghsthdqtfgvshhipdfqfgfvpdfpqffurfetoffkrfenuceurghilhhouhhtmecufedttdenucenucfjughrpefhuffvtgfgfhffkfgjfgesthhqredttderjeenucfhrhhomhepfdhjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtfdcuoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopefqphhtihhplhgvgielkedtqdfrvedpihhnvghtpeejfedrgedrvdehfedrudeguddpmhgrihhlfhhrohhmpehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtpdhrtghpthhtoheprhhsghgspghlfhgpghhrohhuphessghlrggtkhhshhgvvghprdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" References: <336545566.20190511184405@gmail.com> <1UTJHp87NM.2LemuKEGHv@optiplex980-pc> <475810047.20190512125038@gmail.com> Date: Sun, 12 May 2019 12:18:12 -0400 Message-ID: <1UTJHsWaAT.3NHw5CM2m0M@optiplex980-pc> In-Reply-To: <475810047.20190512125038@gmail.com> User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.9 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Chris Don't think the problem is on this end as your's is the one and only e mail where the reply to fills in an unexpected, Blacksheep, e mail address. Perhaps you replied to an earlier Blacksheep reflecte [...] Content analysis details: (-0.9 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:38 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) -0.1 DKIM_VALID_EF Message has a valid DKIM or DK signature from envelope-from domain -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily valid -0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from author's domain X-Scan-Signature: 1bc6486c2865e7dc2ff7578e6d7fc226 Subject: Re: LF: Re: MF amp Content-Type: text/plain; charset=utf-8 X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: X-Spam-Status: No, hits=0.0 required=5.0 tests=TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false Content-Transfer-Encoding: 8bit X-MIME-Autoconverted: from quoted-printable to 8bit by klubnl.pl id x4CGNxRk019536 Chris Don't think the problem is on this end as your's is the one and only e mail where the reply to fills in an unexpected, Blacksheep, e mail address. Perhaps you replied to an earlier Blacksheep reflected e mail of mine and 'harvested' my e mail address to use in the To: box? That may be very different than starting a new 'clean slate' e mail in your e mail client and typing in my e mail address from scratch or doing a copy and paste. Suggest sending me a 'clean slate' e mail as a test to see if this explains the unusual behavior. Jay W1VD ----- Original Message ----- From: Chris Wilson Reply-To: To: Sent: 5/12/2019 7:50:38 AM Subject: Re: LF: Re: MF amp ________________________________________________________________________________ Hello Jay, understood re short probe ground and cap values, thanks. BTW, mail direct to you is still being replied to via Blacksheep! So something is amiss with your mail filtering perhaps? Thanks again, have a good weekend. Sunday, May 12, 2019, 12:16:52 PM, you wrote: > Chris > Sorry for slow reply ... been having intermittant e mail problems. > The value is not critical. What is required is a good ground at > that point. Whatever combination of capacitors works best is what > you want to go with. No doubt this will vary from layout to layout > and capacitor type to capacitor type. Use a scope to monitor voltage > across the capacitors. Don't use the scope probe ground lead or hook > clip as this will not give an accurate reading of what's going on. > Instead, remove the hook clip assembly and fashion a piece of #14 > bare copper wire with several turns and a pigtail. The turns should > be sized to fit tightly over the scope probe ground sleeve. The > short pigtail can be temporarily soldered to the circuit board such > that the 1/4" scope tip comes in contact with the capacitor. The > idea is to keep the scope leads as short as possible. > Jay > ----- Original Message ----- > From: Chris Wilson > Reply-To: > To: > Sent: 5/11/2019 1:44:05 PM > Subject: MF amp > ________________________________________________________________________________ > Hi Jay, > Sorry to be a pain, nearly finished the 1kW MF amp of your design, > please clarify if the center tap transformer to ground cap stack needs > to be exactly 0.56 uF, or if it's a typo and needs to be only 0.5 uF, > what's confusing me is where it states stacking just 0.1 uF MLC > chips... Thanks :) > -- Best regards, Chris mailto:dead.fets@gmail.com