Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x4CBRIXT016196 for ; Sun, 12 May 2019 13:27:20 +0200 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1hPmUD-0000Em-4D for rs_out_1@blacksheep.org; Sun, 12 May 2019 12:17:45 +0100 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1hPmTU-0000Ed-0U for rsgb_lf_group@blacksheep.org; Sun, 12 May 2019 12:17:00 +0100 Received: from resqmta-ch2-08v.sys.comcast.net ([2001:558:fe21:29:69:252:207:40]) by relay1.thorcom.net with esmtps (TLSv1.2:DHE-RSA-AES256-GCM-SHA384:256) (Exim 4.92) (envelope-from ) id 1hPmTS-0001iD-5b for rsgb_lf_group@blacksheep.org; Sun, 12 May 2019 12:16:58 +0100 Received: from resomta-ch2-07v.sys.comcast.net ([69.252.207.103]) by resqmta-ch2-08v.sys.comcast.net with ESMTP id PmMhhHjfg8zNiPmTOhwZxU; Sun, 12 May 2019 11:16:54 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=20190202a; t=1557659814; bh=FMmoXR7Dx//ZqJBiJnsjOopKxdeVR0SIs6FfIFaXULE=; h=Received:Received:From:Subject:To:Content-Type:Date:Message-ID; b=dKlOS7bIFrI6J66FZIGqE8/FhY7eFks9XGnNSXKbjGSrJ7gO0Lm6GyflerTaLR33c 9KJPPhvW7XIQWTV+iei3JrABIHr1yGGkYApp3XcGRd84d9JKIkMsNiZBnK1xoyraCf h248b/Jmw15nygQvLvUZ6X332Wp6D3b1TUP9F8K66U9s5JCqi2x3BIHKKUAAhIrsld 9eD6+V54KaBIAj+GZwZf8P2DS/1++RZoVxP5MHxWh+Ih+llukU3hKOBphODpePjC6s WBcHnHHyzas3pzW89DUKRcGdQNWmygCpKroJN6s4BhGNECu1Oigoqt4wEESWnU+86u ait8Q03MILi2Q== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-07v.sys.comcast.net with ESMTPSA id PmTNhrV1k1wDzPmTOh06xS; Sun, 12 May 2019 11:16:54 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgeduuddrledvgdeflecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddtnecunecujfgurhephffuvfgtgfhffffkjggfsehtqhertddtreejnecuhfhrohhmpedfjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdfuceojhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvtheqnecukfhppeejfedrgedrvdehfedrudegudenucfrrghrrghmpehhvghlohepqfhpthhiphhlvgigleektddqrfevpdhinhgvthepjeefrdegrddvheefrddugedupdhmrghilhhfrhhomhepjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdprhgtphhtthhopehrshhgsggplhhfpghgrhhouhhpsegslhgrtghkshhhvggvphdrohhrghenucevlhhushhtvghrufhiiigvpedt X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" References: <336545566.20190511184405@gmail.com> Date: Sun, 12 May 2019 07:16:52 -0400 Message-ID: <1UTJHp87NM.2LemuKEGHv@optiplex980-pc> In-Reply-To: <336545566.20190511184405@gmail.com> User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.9 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Chris Sorry for slow reply ... been having intermittant e mail problems. The value is not critical. What is required is a good ground at that point. Whatever combination of capacitors works best is what you want to go with. No doubt this will vary from layout to layout and [...] Content analysis details: (-0.9 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:40 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) -0.1 DKIM_VALID_EF Message has a valid DKIM or DK signature from envelope-from domain -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily valid -0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from author's domain X-Scan-Signature: 3b8620872b19e25fb6f4dfaf1256edc3 Subject: LF: Re: MF amp Content-Type: text/plain; charset=utf-8 X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: X-Spam-Status: No, hits=0.0 required=5.0 tests=TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false Content-Transfer-Encoding: 8bit X-MIME-Autoconverted: from quoted-printable to 8bit by klubnl.pl id x4CBRIXT016196 Chris Sorry for slow reply ... been having intermittant e mail problems. The value is not critical. What is required is a good ground at that point. Whatever combination of capacitors works best is what you want to go with. No doubt this will vary from layout to layout and capacitor type to capacitor type. Use a scope to monitor voltage across the capacitors. Don't use the scope probe ground lead or hook clip as this will not give an accurate reading of what's going on. Instead, remove the hook clip assembly and fashion a piece of #14 bare copper wire with several turns and a pigtail. The turns should be sized to fit tightly over the scope probe ground sleeve. The short pigtail can be temporarily soldered to the circuit board such that the 1/4" scope tip comes in contact with the capacitor. The idea is to keep the scope leads as short as possible. Jay ----- Original Message ----- From: Chris Wilson Reply-To: To: Sent: 5/11/2019 1:44:05 PM Subject: MF amp ________________________________________________________________________________ Hi Jay, Sorry to be a pain, nearly finished the 1kW MF amp of your design, please clarify if the center tap transformer to ground cap stack needs to be exactly 0.56 uF, or if it's a typo and needs to be only 0.5 uF, what's confusing me is where it states stacking just 0.1 uF MLC chips... Thanks :) -- Best regards, Chris mailto:dead.fets@gmail.com