Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x2KAo7M3007472 for ; Wed, 20 Mar 2019 11:50:14 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1h6YTz-0007nE-PI for rs_out_1@blacksheep.org; Wed, 20 Mar 2019 10:30:03 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1h6YTL-0007n3-JD for rsgb_lf_group@blacksheep.org; Wed, 20 Mar 2019 10:29:23 +0000 Received: from resqmta-ch2-01v.sys.comcast.net ([2001:558:fe21:29:69:252:207:33]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1h6YTJ-0003ma-Cf for rsgb_lf_group@blacksheep.org; Wed, 20 Mar 2019 10:29:22 +0000 Received: from resomta-ch2-10v.sys.comcast.net ([69.252.207.106]) by resqmta-ch2-01v.sys.comcast.net with ESMTP id 6YPRhLngiLP4M6YTFhtTIu; Wed, 20 Mar 2019 10:29:17 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1553077757; bh=mDwZt6aZkjG1pyd+Y6NTj5Tpe32Yl9nCOkL4YSB/wUc=; h=Received:Received:From:Subject:To:Content-Type:MIME-Version:Date: Message-ID; b=hsA0RaTUw2Ba2O1/U+e+bDLwbMmLZFtGrb1JSvRRRzOr6caoNXUkE105ITgUmttqz K8pSqFY5QA6zoVYWPfI14NweOfxfZ4d0+bMz6XnkAZJ1ADYT7zlSAYUYCMsexMt3NS oATMQSuxDE9hvKMOdV699ZENqstijkYhjaBCWY1GwELXKGBy2MYhunVA2GCWH9OEv9 5ch86taioMxGpc2weJFkZBn/ZIOsfm2tikHihElc2xaKpoLF3/iV6TydWlckW2dZTe qgPgnJxyKiQaflEBoF0EePucHQi4Cr7cub2JVSjFY/ZRX2OJqazEHbRUfsKCnhXLQn ldwrEmWFuPflg== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-10v.sys.comcast.net with ESMTPSA id 6YTDh01iN8JQI6YTDhh1Uj; Wed, 20 Mar 2019 10:29:17 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedutddrieeigddujecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddtnecuogfntfdquehouhhnugdqtfefvdculdehmdenucfjughrpefhuffvtgggfhffkfgjfgesrgdtreertderjeenucfhrhhomhepfdhjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtfdcuoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopefqphhtihhplhgvgielkedtqdfrvedpihhnvghtpeejfedrgedrvdehfedrudeguddpmhgrihhlfhhrohhmpehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtpdhrtghpthhtoheprhhsghgspghlfhgpghhrohhuphessghlrggtkhhshhgvvghprdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-Xfinity-VMeta: sc=5;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" MIME-Version: 1.0 References: <1UTFt96gAH.FejNyWVD9P4@optiplex980-pc> <5C90E570.6080104@posteo.de> <5C9159C6.1080208@posteo.de> Date: Wed, 20 Mar 2019 06:29:14 -0400 Message-ID: <1UTFuEn1IU.HVXPDNRghl7@optiplex980-pc> In-Reply-To: <5C9159C6.1080208@posteo.de> User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: Stefan, EbNauteers Apologies for very late start ;~( 0200 Rank 0 EbN0 6.5 dB car EbN0 9.0 dB SUNNY 0300 Rank 0 EbN0 6.0 dB car EbN0 9.2 dB SUNNY 0400 Rank 0 EbN0 6.0 dB car EbN0 8.6 dB SUNNY 0500 Rank 0 EbN0 -3.5 dB car EbN0 1.8 dB SUNNY Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:33 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message X-Scan-Signature: 20fb97b64762a0bd80c12a4b2f6724b0 Subject: Re: LF: DK7FC EbNaut Content-Type: multipart/alternative; boundary="AbRthIxkVIXNsV0EtxrLje6izxC8hWr=_C" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: X-Spam-Status: No, hits=0.5 required=5.0 tests=HTML_40_50,HTML_MESSAGE, TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format --AbRthIxkVIXNsV0EtxrLje6izxC8hWr=_C Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline Stefan, EbNauteers Apologies for very late start ;~(=20 0200 Rank 0 EbN0 6.5 dB car EbN0 9.0 dB SUNNY 0300 Rank 0 EbN0 6.0 dB car EbN0 9.2 dB SUNNY 0400 Rank 0 EbN0 6.0 dB car EbN0 8.6 dB SUNNY 0500 Rank 0 EbN0 -3.5 dB car EbN0 1.8 dB SUNNY The decoder went through a number of 'gyrations' on the 0500 transmiss= ion and=20 settled on that shown above. Jay W1VD ----- Original Message ----- From: DK7FC Reply-To: To: Sent: 3/19/2019 5:06:14 PM Subject: Re: LF: DK7FC EbNaut =2E..first transmission failed. First valid one will start at 22 UTC. Am 19.03.2019 13:49, schrieb DK7FC:=20 f =3D 137.545 kHz Start time: 19.MAR.2019 21:00:00.3 UTC (hourly, including 5 UTC) Symbol period: 2 s Characters: 5 CRC bits: 16 Coding 16K21A Antenna current: 4 A Duration: 35:12 [mm:ss] 73, Stefan --AbRthIxkVIXNsV0EtxrLje6izxC8hWr=_C Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline
Stefan, EbNauteers
 
Apologies for very late start ;~(
 
0200 Rank 0 EbN0 6.5 dB car EbN0 9.0 dB SUNNY
0300 Rank 0 EbN0 6.0 dB car EbN0 9.2 dB SUNNY
0400 Rank 0 EbN0 6.0 dB car EbN0 8.6 dB SUNNY
0500 Rank 0 EbN0 -3.5 dB car EbN0 1.8 dB SUNNY
 
The decoder went through a number of 'gyrations' on the 0500 tran= smission and settled on that shown above.
 
Jay W1VD
 
 
 
----- Original Message -----
Sent: 3/19/2019 5:06:14 PM
Subject: Re: LF: DK7FC EbNaut
=2E..first transmission failed. First valid one will start at 22 UTC.<= BR>
Am 19.03.2019 13:49, schrieb DK7FC:=20

f =3D 137.545 kHz
Start time: 19.MAR.2019  21:00:00.3 UTC= (hourly, including 5 UTC)
Symbol period: 2 s
Characters: 5
C= RC bits: 16
Coding 16K21A
Antenna current: 4 A
Dur= ation: 35:12 [mm:ss]

73, Stefan
--AbRthIxkVIXNsV0EtxrLje6izxC8hWr=_C--