Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x2JAYktm032542 for ; Tue, 19 Mar 2019 11:34:53 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1h6Byo-0004PC-Tq for rs_out_1@blacksheep.org; Tue, 19 Mar 2019 10:28:22 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1h6Byk-0004P3-Et for rsgb_lf_group@blacksheep.org; Tue, 19 Mar 2019 10:28:18 +0000 Received: from resqmta-ch2-09v.sys.comcast.net ([2001:558:fe21:29:69:252:207:41]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1h6Byh-00049H-RK for rsgb_lf_group@blacksheep.org; Tue, 19 Mar 2019 10:28:17 +0000 Received: from resomta-ch2-12v.sys.comcast.net ([69.252.207.108]) by resqmta-ch2-09v.sys.comcast.net with ESMTP id 6BmphnasdwKWq6Bych3jJ9; Tue, 19 Mar 2019 10:28:10 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1552991290; bh=6xr83U0xOboLfHNtKDtutqtGMdp1EV4hISXQhE88wfY=; h=Received:Received:From:Subject:To:Content-Type:MIME-Version:Date: Message-ID; b=Nj7Tlh3EBiu8PEB4JKlHByhzTdgpbVhqxIBe/4vK6IhbyEg1afoLmPGCXoq6KIRVW oJXK6FnFu/una/Kl5l+CyYdh9a92HjDYfMdZ1E71XOuZ8R+C2P2G/SnasQUYQmyWo4 11+gYzXbTrfEhXVQaHCD5QmUvfdJSTKQDKVTmn6c5awaCGk9NXcbTwu3CHfsbtgzJx jVqwjON8xyGYZEnLfDaH8aWp9yEyxq3J90HKyOMEEtXlwhb5TMK4lRPaWekOQTHhVQ PKDhf9H1gz8Y7l6ebVYyNpTu9aC6kbUbe2lTC8M0xT82+fHZ7wyAyulYAubIXhLWmj sWAGQP+sOPQgg== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-12v.sys.comcast.net with ESMTPSA id 6BybhV96weQJ16BybhV2zi; Tue, 19 Mar 2019 10:28:10 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedutddrieeggddukecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddtnecuogfntfdquehouhhnugdqtfefvdculdehmdenucfjughrpefhuffvtgggfffkfgesrgdtreertderjeenucfhrhhomhepfdhjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtfdcuoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopefqphhtihhplhgvgielkedtqdfrvedpihhnvghtpeejfedrgedrvdehfedrudeguddpmhgrihhlfhhrohhmpehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtpdhrtghpthhtoheprhhsghgspghlfhgpghhrohhuphessghlrggtkhhshhgvvghprdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-Xfinity-VMeta: sc=5;st=legit From: "jrusgrove@comcast.net" To: "(rsgb_lf_group@blacksheep.org)" MIME-Version: 1.0 Date: Tue, 19 Mar 2019 06:28:09 -0400 Message-ID: <1UTFt96gAH.FejNyWVD9P4@optiplex980-pc> User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: Stefan Late start ... repairs after dark required on the large loop RX antenna wire 600' out in the woods ... recent wind storm or animals to blame. Speaking of animals ... night before a pack of coyotes wer [...] Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:41 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message X-Scan-Signature: d7907c3bf895ca41e0bedc3fa074f0d4 Subject: LF: DK7FC EbNaut Content-Type: multipart/alternative; boundary="M=_acVmy5M4uJkqIfGvEIkMLs34Eiq8deX" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: X-Spam-Status: No, hits=0.8 required=5.0 tests=HTML_30_40,HTML_MESSAGE autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format --M=_acVmy5M4uJkqIfGvEIkMLs34Eiq8deX Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline Stefan Late start ... repairs after dark required on the large loop RX antenn= a wire=20 600' out in the woods ... recent wind storm or animals to blame. Speak= ing of animals ... night before a pack of coyotes were yipping and how= ling it up at 3 AM in the side yard. Was looking over my shoulder duri= ng antenna repairs ;~) . =20 0000 - 0100 - 0200 Rank 4 EbN0 0.1 dB car EbN0 0.2 dB BLACKSHEEP FOREVER *THUMBSUP* 0300 - 0400 - 0500 - Not sure why such poor results last night. Will look into it later whe= n I get time ... operator error suspected. Jay W1VD=20 --M=_acVmy5M4uJkqIfGvEIkMLs34Eiq8deX Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline
Stefan
 
Late start ... repairs after dark required on the large loop= RX antenna wire 600' out in the woods ... recent wind storm or&n= bsp;animals to blame. Speaking of animals ... night before a pack= of coyotes were yipping and howling it up at 3 AM in the si= de yard. Was looking over my shoulder during antenna repairs ;~) .&nbs= p;   
 
0000 -
0100 -
0200 Rank 4 EbN0 0.1 dB car EbN0 0.2 dB BLACKSHEEP FOREVER *= THUMBSUP*
0300 -
0400 -
0500 -
 
Not sure why such poor results last night. Will look into it= later when I get time ... operator error suspected.
 
Jay W1VD 
--M=_acVmy5M4uJkqIfGvEIkMLs34Eiq8deX--