Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x1QJGwK5008272 for ; Tue, 26 Feb 2019 20:16:59 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gyi9O-00034H-MV for rs_out_1@blacksheep.org; Tue, 26 Feb 2019 19:12:22 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gyi9M-000344-DS for rsgb_lf_group@blacksheep.org; Tue, 26 Feb 2019 19:12:20 +0000 Received: from resqmta-ch2-05v.sys.comcast.net ([2001:558:fe21:29:69:252:207:37]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1gyi9J-0001Fw-NS for rsgb_lf_group@blacksheep.org; Tue, 26 Feb 2019 19:12:19 +0000 Received: from resomta-ch2-07v.sys.comcast.net ([69.252.207.103]) by resqmta-ch2-05v.sys.comcast.net with ESMTP id yd6Ugr4CEkzMNyi9FgAA9p; Tue, 26 Feb 2019 19:12:13 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1551208333; bh=VqNDxeesj20duH65hZWqv2aX3J9raVLyOJITS7dty2c=; h=Received:Received:Message-ID:From:To:Subject:Date:MIME-Version: Content-Type; b=Yul/m3ys0cA/R3mpWoQOrRCsjxXJQq2qnLiwBcS2jKykYWnvk36wTRVcRGA5jJO/A DNlaDVXkduOCIOyQxMTDaZJuIhPgTAnre83E1T+rTwwCTkJa4HOTq9dTnQdRS2k8N0 wuTGsxn9v4eyuRioXBgyX4AVmp6PCbQXWl6TVyN4O1e7OLUsZUL1F95PXXTSQ/DTX9 A3tXnGhLvwJGaL4A9EZbi9nUY9DmYtFYmSKNdnCqXKJhMpiHic/YDawxWYPWrJfO5J zsBnREffokomMCz4wImv3y+tYLFOgx6FbcD1Udo4Ql2XDh5v/q62IhmB4OVgQZkvP7 EWM9kJjbm+ufw== Received: from DELL4 ([73.4.253.141]) by resomta-ch2-07v.sys.comcast.net with ESMTPA id yi9Egqk2R19IPyi9EgXPvh; Tue, 26 Feb 2019 19:12:13 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedutddrudelgdduvdegucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuvehomhgtrghsthdqtfgvshhipdfqfgfvpdfpqffurfetoffkrfenuceurghilhhouhhtmecufedttdenucenucfjughrpefkhffvfhfuffggtgfgrfgioffqsehtjeejtddutdejnecuhfhrohhmpeeojhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvtheqnecukfhppeejfedrgedrvdehfedrudegudenucfrrghrrghmpehhvghlohepfffgnffngedpihhnvghtpeejfedrgedrvdehfedrudeguddpmhgrihhlfhhrohhmpehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtpdhrtghpthhtoheprhhsghgspghlfhgpghhrohhuphessghlrggtkhhshhgvvghprdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-Xfinity-VMeta: sc=0;st=legit Message-ID: <823BBA7099F84CE9924D2D9E7E379C05@DELL4> From: To: References: <942860C848184BA2A0A9103E0EE56DF7@DELL4> <1UTEEgOcyQ.DAejAuRZtn9@optiplex980-pc> <92784b07-a799-fb4e-9080-e1e8bb167b75@n1bug.com> <1UTEEhG1Ft.EdI1dlVbFOZ@optiplex980-pc> <3062ef19-bb69-3187-e8db-6a6bf5050739@n1bug.com> <234098919.20190226111836@gmail.com> <0a79de5c-3274-caae-c000-d5f49bb44540@no3m.net> <21240445.20190226160950@gmail.com> <57e33c0d-6904-9010-a1c8-69b80f474068@no3m.net> <1191469216.20190226175207@gmail.com> Date: Tue, 26 Feb 2019 14:12:12 -0500 MIME-Version: 1.0 X-Priority: 3 X-MSMail-Priority: Normal X-Mailer: Microsoft Outlook Express 6.00.2900.5512 X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2900.5512 X-Spam-Score: -0.5 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: Anyone have a U3S schematic handy? Link to same? Jay W1VD ----- Original Message ----- From: "N1BUG" To: Sent: Tuesday, February 26, 2019 2:01 PM Subject: Re: LF: Class D current spikes Content analysis details: (-0.5 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:37 listed in] [list.dnswl.org] 0.2 STOX_REPLY_TYPE No description available. -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) X-Scan-Signature: 6ffbd2c9950b634d6cc91f9565b01a8b Subject: Re: LF: Class D current spikes Content-Type: text/plain; format=flowed; charset="utf-8"; reply-type=original Content-Transfer-Encoding: 7bit X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: * X-Spam-Status: No, hits=1.9 required=5.0 tests=FORGED_MUA_OUTLOOK, NO_REAL_NAME autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false Anyone have a U3S schematic handy? Link to same? Jay W1VD ----- Original Message ----- From: "N1BUG" To: Sent: Tuesday, February 26, 2019 2:01 PM Subject: Re: LF: Class D current spikes > Eric, > > I I have always run my U3S through the W1VD doubler. Never had any > problems with blown FETs with that setup, even when I tested at 1 kW > under Part 5 license. There is apparently something different about > the U3S at end of RF envelope. > > 73, > Paul > > > On 2/26/19 12:52 PM, Chris Wilson wrote: >> >> >> Hello Eric, >> >> No, I have always run the U3S in X2 mode as far as I can remember. No >> doubler, no squarer, just straight out of CLK0 to Pin 3 of the 74F74. >> And no issues at all. Thanks. BTW, I really admire your old gear on >> your web site, awesome build standards and so nice to look at! >> >> Tuesday, February 26, 2019, 5:35:10 PM, you wrote: >> >>> Just to clarify... did you say previously that the U3S also worked fine >>> running at 1x and feeding a doubler, squarer, etc. also? >