Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x1QBiBUU006103 for ; Tue, 26 Feb 2019 12:44:12 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gyb5O-00013a-3z for rs_out_1@blacksheep.org; Tue, 26 Feb 2019 11:39:46 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gyb5I-00013N-S0 for rsgb_lf_group@blacksheep.org; Tue, 26 Feb 2019 11:39:40 +0000 Received: from resqmta-ch2-11v.sys.comcast.net ([2001:558:fe21:29:69:252:207:43]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1gyb5G-0000EG-FF for rsgb_lf_group@blacksheep.org; Tue, 26 Feb 2019 11:39:39 +0000 Received: from resomta-ch2-09v.sys.comcast.net ([69.252.207.105]) by resqmta-ch2-11v.sys.comcast.net with ESMTP id yayFgthYSdcv3yb5Egtd7s; Tue, 26 Feb 2019 11:39:36 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1551181176; bh=eattE5MPrhywaCFB984Rgy5lMbtrqdLYEVdGI1y7neg=; h=Received:Received:From:Subject:To:Content-Type:Date:Message-ID; b=TIwAAwBgefDI29DsmK7lWEaI6C7HWTGd+CnSuS9Eh0gcgP+47SWja/xlIwb4XR/WS Vb5e3lFd8uJMeN9gYX5JLvEuTTHPA3/ZrVbSO23rjqkj6wPc99lDjaFIKCYLV/odLi ATR52s74LbxqupX6pHYQJZnZ+oIKC12uRvGlyMQ3KqJDt0Zu+dSAB3l37AaZ20tzwD rK+a7eoqKrmUNw7Uf8Ro47dOBRzdHzJyRhsGc82yYnINDLguzNp197Us9SsJlBWPt0 ebzuu6iUfFuAzoZgweNaJv+NLhGivBK7XauKJzrMFXBoT4DfbpM8TmrFkR2P/pOMbh tRBtEOh1RZfpg== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-09v.sys.comcast.net with ESMTPSA id yb5CgwSAl9uakyb5Dgzqb2; Tue, 26 Feb 2019 11:39:35 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedutddrudelgdefvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddtnecunecujfgurhephffuvfgtgfhffffkjggfsehtqhertddtreejnecuhfhrohhmpedfjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdfuceojhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvtheqnecukfhppeejfedrgedrvdehfedrudegudenucfrrghrrghmpehhvghlohepqfhpthhiphhlvgigleektddqrfevpdhinhgvthepjeefrdegrddvheefrddugedupdhmrghilhhfrhhomhepjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdprhgtphhtthhopehrshhgsggplhhfpghgrhhouhhpsegslhgrtghkshhhvggvphdrohhrghenucevlhhushhtvghrufhiiigvpedt X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" References: <942860C848184BA2A0A9103E0EE56DF7@DELL4> <1UTEEgOcyQ.DAejAuRZtn9@optiplex980-pc> <92784b07-a799-fb4e-9080-e1e8bb167b75@n1bug.com> <1UTEEhG1Ft.EdI1dlVbFOZ@optiplex980-pc> <3062ef19-bb69-3187-e8db-6a6bf5050739@n1bug.com> <234098919.20190226111836@gmail.com> Date: Tue, 26 Feb 2019 06:39:34 -0500 Message-ID: <1UTEFdKsXm.GN1YLfZiPrF@optiplex980-pc> In-Reply-To: <234098919.20190226111836@gmail.com> User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: Chris When running Opera here I used the same setup as on cw. A continuous source of RF attached to the input of the amplifier with the Opera signal keying the amplifier directly. There was never a problem [...] Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:43 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) X-Scan-Signature: 195b836cb7437e99aa05107459888659 Subject: Re: LF: Class D current spikes Content-Type: text/plain; charset=utf-8 X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: X-Spam-Status: No, hits=0.0 required=5.0 tests=TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false Content-Transfer-Encoding: 8bit X-MIME-Autoconverted: from quoted-printable to 8bit by klubnl.pl id x1QBiBUU006103 Chris When running Opera here I used the same setup as on cw. A continuous source of RF attached to the input of the amplifier with the Opera signal keying the amplifier directly. There was never a problem in many hours of operation. Are the leading and falling edges of your Opera signal shaped similar to a cw signal? Jay W1VD ----- Original Message ----- From: Chris Wilson Reply-To: To: N1BUG Sent: 2/26/2019 6:18:36 AM Subject: Re: LF: Class D current spikes ________________________________________________________________________________ Hello N1BUG, Just to add things were MUCH worst using a X2 multiplier circuit (Jay's). I now use an exciter frequency of X2 direct both from the U3S, and as of late X2 from the TS-590 into a simple squarer and use WSPR in the "Advanced" X2 mode to correct the WSPR tones. No issues at all with either. OPERA is a no no as of this time, it is a FET killer :) Don't know why though. It would be great to get to the bottom of all this! Tuesday, February 26, 2019, 11:05:15 AM, you wrote: > Jay, > I was using an HF transceiver in CW mode through a down converter. > Other FETs were lost at end of envelope while running JT9 with the > transceiver in USB being fed audio from a sound card. The latest was > with audio from a different sound card into the new phasing exciter. > I have never lost a FET while running with the U3S. > 73, > Paul -- Best regards, Chris mailto:dead.fets@gmail.com