Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x1Q23hfU013440 for ; Tue, 26 Feb 2019 03:03:45 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gyS0T-0006jc-BF for rs_out_1@blacksheep.org; Tue, 26 Feb 2019 01:58:05 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gyS0M-0006jT-Kw for rsgb_lf_group@blacksheep.org; Tue, 26 Feb 2019 01:57:58 +0000 Received: from resqmta-ch2-03v.sys.comcast.net ([2001:558:fe21:29:69:252:207:35]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1gyS0J-0007VK-4x for rsgb_lf_group@blacksheep.org; Tue, 26 Feb 2019 01:57:57 +0000 Received: from resomta-ch2-12v.sys.comcast.net ([69.252.207.108]) by resqmta-ch2-03v.sys.comcast.net with ESMTP id yQgjgbMxj0R3KyS0EggQ0K; Tue, 26 Feb 2019 01:57:50 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1551146270; bh=Ykjkzaa/81L+Hgm0Bpeat7kq74j8zTZdAmEXb5bhZAM=; h=Received:Received:From:Subject:To:Content-Type:Date:Message-ID; b=LpUY131n0rFlGt5BdDDbQaRRmwXlSpOj2qT9QM193MerC2YlX+CDZxVw9mUFKyvSM ft2YvHeFvt+SaL++ygTvwD1G4ant/HHfZ18QngtNJjuLQwlBqEkO1Dz2sSfmZlyibo G3R3CPqaucjEUJV8zzAJI+Vea3yLoaM6aDiYRasnIbHgFMOMtaH8ibOk1cAhBz1pia uf0kfQFQdeoH8azRZzV5YlvpgNRYM28wOxyYoZamBR1yFed3/0EFY7MvbYpp6vJRPq uJYlOYFv1dVDtOHDfJ4A9ykSBBjT3uTP5A07TUcmxr+fp22LkIAj869peX/yPCjKWv qRw94BA+hAFmw== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-12v.sys.comcast.net with ESMTPSA id yS0DgWeKWFPHiyS0DgxpBG; Tue, 26 Feb 2019 01:57:50 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedutddrudekgdegudcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddtnecunecujfgurhephffuvfgtgfhffffkjggfsehtqhertddtreejnecuhfhrohhmpedfjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdfuceojhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvtheqnecukfhppeejfedrgedrvdehfedrudegudenucfrrghrrghmpehhvghlohepqfhpthhiphhlvgigleektddqrfevpdhinhgvthepjeefrdegrddvheefrddugedupdhmrghilhhfrhhomhepjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdprhgtphhtthhopehrshhgsggplhhfpghgrhhouhhpsegslhgrtghkshhhvggvphdrohhrghenucevlhhushhtvghrufhiiigvpedt X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" References: <942860C848184BA2A0A9103E0EE56DF7@DELL4> <1UTEEgOcyQ.DAejAuRZtn9@optiplex980-pc> <92784b07-a799-fb4e-9080-e1e8bb167b75@n1bug.com> Date: Mon, 25 Feb 2019 20:57:48 -0500 Message-ID: <1UTEEhG1Ft.EdI1dlVbFOZ@optiplex980-pc> In-Reply-To: <92784b07-a799-fb4e-9080-e1e8bb167b75@n1bug.com> User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: Paul Was this with a continuous frequency source at the input (HP3325A maybe?) and using a keyer plugged into the amplifier key jack? Jay Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:35 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) X-Scan-Signature: 131286aabc28dd54c072e5e89638c651 Subject: Re: LF: Class D current spikes Content-Type: text/plain; charset=utf-8 X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: X-Spam-Status: No, hits=0.0 required=5.0 tests=TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false Content-Transfer-Encoding: 8bit X-MIME-Autoconverted: from quoted-printable to 8bit by klubnl.pl id x1Q23hfU013440 Paul Was this with a continuous frequency source at the input (HP3325A maybe?) and using a keyer plugged into the amplifier key jack? Jay ----- Original Message ----- From: N1BUG Reply-To: To: Sent: 2/25/2019 7:50:17 PM Subject: Re: LF: Class D current spikes ________________________________________________________________________________ Jay, Good idea, but it isn't just the sound card. I can guarantee one or more destroyed FETs after sending two or three characters of CW where computer and sound card are not involved at all. I can also confirm that with CW the FETs are still blowing at the end of RF envelope. I can hear the fuse when it opens. I tried some very slow CW to confirm exactly when it was happening. 73, Paul On 2/25/19 7:30 PM, jrusgrove@comcast.net wrote: > Chris > > Thanks for the waveforms ... very informative. Sure looks like > something is triggering the input of the amplifier and thus > causing the problem. > > Since the problem doesn't exist with U3S's (which generates the > various modes internally) driving the amplifier (either directly > or through a frequency doubler) one has to wonder what the > difference is between the U3S and the other exciter setups that > cause the problem. The fact that the U3S / amplifier combination > works correctly would argue that the 'problem' is likely not the > amplifier. > > The one thing that the non U3S setups have in common is that the > modes are generated by software / computer / sound card. Think > the first step in tracking down the problem would be to see if > there are any unexpected outputs from the soundcard that are > causing the problem. When you get a chance maybe you can capture > waveforms of the sound card output up to and after the end of a > transmission. > > Assume that you have disabled all 'computer sounds' on the > machines that are supplying audio for the various modes? > > Jay W1VD > > > > > > ----- Original Message ----- From: "Chris Wilson" > To: "N1BUG" > Sent: Monday, February 25, 2019 5:02 PM Subject: Re: LF: Class D > current spikes > > >> >> >> Hello Paul. everyone >> >> A series of overlapping scope captures at end of WSPR >> sequence with expensive high voltage / current Wolfspeed >> FET's that usually survived, into the antenna and into a 10kW >> dummy load, taken after the choke and also at the drains of >> the W1VD amp. Driver TS-590 / W1VD doubler, and W1VD amp ( >> end part of another circuit). U3S does not show anything like >> this oscillating end to a TX sequence.: >> >> http://www.chriswilson.tv/wolfspeed-choke-and-drain-50v-smps-antenna.zip >> >> >> http://www.chriswilson.tv/wolfspeed-choke-and-drain-50v-smps-dummy-load.zip >> >> Green trace drain, yellow after the choke. >> >> >> >> Monday, February 25, 2019, 4:34:05 PM, you wrote: >> >>> Chris, LF, >> >>> Yes, although I run mine differently. I use the full output >>> of the U3S into a doubler. I have run WSPR, JT9, and DFCW >>> from the U3S without having any problems. I have also >>> extensively used CW ID with the U3S and amp without problems. >>> Yet both other exciters blow FETs at the instant RF stops. >> >>> Chris, I know you are busy but if you get a chance I would >>> like to see those scope captures. I thought I had it figured >>> out that this is a voltage mode amp and should be seeing >>> current spikes, but maybe I still have that wrong! If they >>> are voltage spikes that may be easier to control. >> >>> One thing I would like to learn more about is why do the >>> drivers leave one phase high for a longer period than a half >>> cycle when RF stops. What causes this? Is this only with >>> specific FET drivers or are all of them prone to this? >> >>> 73, Paul >> >> >>> On 2/25/19 11:13 AM, Eric NO3M wrote: >>>> Chris, et.al. >>>> >>>> N1BUG relayed the same information regarding the U3S and >>>> class-D amp behavior, so your observation is not a one >>>> off... >>>> >>>> >>>> >>>>> >>>>> I have a series of scope captures from my W1VD amp >>>>> showing huge voltage spikes on the FET drains at the end >>>>> of WSPR and especially OPERA TX sequences. I suspected >>>>> inductance was the cause. In fact I try not use OPERA at >>>>> high power as i am pretty sure to kill a FET after a few >>>>> sessions... Oddly (although I hope msomeone more >>>>> knowlegeable has the answer), using WSPR from my U3S >>>>> direct from CLK0 of th Si535a or whatever it is never >>>>> causes these spikes... Or at least they are well >>>>> contained.