Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x0TBZwGf021897 for ; Tue, 29 Jan 2019 12:36:05 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1goRUt-0007Ya-4g for rs_out_1@blacksheep.org; Tue, 29 Jan 2019 11:24:07 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1goRUp-0007YR-Kc for rsgb_lf_group@blacksheep.org; Tue, 29 Jan 2019 11:24:03 +0000 Received: from resqmta-ch2-05v.sys.comcast.net ([2001:558:fe21:29:69:252:207:37]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1goRUn-0007C5-FL for rsgb_lf_group@blacksheep.org; Tue, 29 Jan 2019 11:24:02 +0000 Received: from resomta-ch2-19v.sys.comcast.net ([69.252.207.115]) by resqmta-ch2-05v.sys.comcast.net with ESMTP id oRSIgZPM8euuRoRUigcyjo; Tue, 29 Jan 2019 11:23:56 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1548761036; bh=cEWxOJCE9UjYdU3vO9Slp7RJCRjdmDNEVHpEkKQifj4=; h=Received:Received:From:Subject:To:Content-Type:MIME-Version:Date: Message-ID; b=TM2wa9vVi51aPpoxOVr7bVuCRhfoSBkeKARp5e4qgZMhM8grQJfeVZATcTQc/a7qN QADxiZ8eS29Wx6Hc7IizuE14t1ZO3XVT9dSDyOxmUTK86eTf0A9mOFxS3FTA25cYLh uGmuyWY8e6Mi383e5LdWVdu8KLRoY3krzTxgbyh2L2hXGnLmYcmjY7shFq4G4mluE2 cg2XnyNuFcupK/inTGDJ3zFGzm0tQUH0CncZPgus8i2Onz12P5qXaADxU7pshHhhiV gYtvE0D6qrEzDMAzX2opYtlDdEr/vJ9EOmlphQA4lXaAYSkCQxMjzVPgF1kaq42WUQ HEnovUkP/5cNg== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-19v.sys.comcast.net with ESMTPSA id oRUfgYormEuGGoRUgg5ZNK; Tue, 29 Jan 2019 11:23:56 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtledrjedvgddvkecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddtnecuogfuuhhsphgvtghtffhomhgrihhnucdlgeelmdenogfntfdquehouhhnugdqtfefvdculdehmdenucfjughrpefhuffvtgggfhffkfgjfgesrgdtreertderjeenucfhrhhomhepfdhjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtfdcuoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucffohhmrghinhepughrohhpsghogidrtghomhenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopefqphhtihhplhgvgielkedtqdfrvedpihhnvghtpeejfedrgedrvdehfedrudeguddpmhgrihhlfhhrohhmpehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtpdhrtghpthhtoheprhhsghgspghlfhgpghhrohhuphessghlrggtkhhshhgvvghprdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-Xfinity-VMeta: sc=54;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" MIME-Version: 1.0 References: <1690723859.1653766.1548539148821.ref@mail.yahoo.com> <1UTCWet7ZZ.BO7EfIhLRDp@optiplex980-pc> <9B71DE4D028A40818CACBB3955CFE65E@DELL4> Date: Tue, 29 Jan 2019 06:23:53 -0500 Message-ID: <1UTCXkg84W.CePFxphFYqG@optiplex980-pc> In-Reply-To: User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: Riccardo Only two decodes last night. Note that DCF39 has been on the weak side the past couple nights. 2300 Rank 249 car Eb/N0 0.0 dB Eb/N0 0.1 dB DXW-SDR 2330 - 0000 - 0030 - 0100 - 0130 - 0200 - 0230 - 0300 - 0330 Rank 1 car Eb/N0 0.8 dB Eb/N0 -0.2 dB ******* 0400 - 0430 - 0500 - 0530 - 0600 - 0630 - Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:37 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message X-Scan-Signature: a2bcfa97ac72b4287723b26fb0320e99 Subject: Re: LF: Ebnaut tonite from JN80 Content-Type: multipart/alternative; boundary="JYgHLPsSm64pKQmDp=_VYOHl5Ei5beZWnq" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: * X-Spam-Status: No, hits=1.5 required=5.0 tests=HTML_40_50,HTML_MESSAGE, MAILTO_TO_SPAM_ADDR,TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format --JYgHLPsSm64pKQmDp=_VYOHl5Ei5beZWnq Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline Riccardo Only two decodes last night. Note that DCF39 has been on the weak side= the past=20 couple nights.=20 2300 Rank 249 car Eb/N0 0.0 dB Eb/N0 0.1 dB DXW-SDR 2330 - 0000 - 0030 - 0100 - 0130 - 0200 - 0230 - 0300 - 0330 Rank 1 car Eb/N0 0.8 dB Eb/N0 -0.2 dB ******* 0400 - =20 0430 - 0500 - 0530 - 0600 - 0630 - And one decode from the previous night ... finally found your TX sched= ule ;~) .=20 0300 Rank 80 car Eb/N0 1.0 dB Eb/N0 -0.6 dB 73 Jay W1VD ----- Original Message ----- From: Riccardo Zoli Reply-To: To: LF Group Sent: 1/28/2019 4:21:19 PM Subject: Re: LF: Ebnaut tonite from JN80 Jay, Domenico, LF now it's raining and the antenna current it's quite unstable. Anyway, tonite=20 I'll try another TX session with a new Spectrum Lab configuration. In particular, I'd=20 simply use the aux out as "quadrature output for I/Q modulator" instea= d=20 external HDSDR program and without VAC: https://www.dropbox.com/s/f7lmf7na60rhgh0/Screenshot_20190128-221811.j= pg?dl=3D0 The image rejection optimization isn't possible by software but it's a= lready=20 quite good. So: QRG: 137546.2 Hz Coding 8K19A CRC 15 3 sec./sym 7 characters Duration: 30 min. Every 30 min., 1st on 2200z, last on 0700z Many thanks. All the best 73 de Riccardo IW4DXW Il giorno Lun 28 Gen 2019, 20:45 ha scritto: Riccardo What was your transmission schedule last night ... I must have missed = it. Jay W1VD ----- Original Message -----=20 From: Riccardo Zoli=20 To: LF Group=20 Sent: Monday, January 28, 2019 1:22 PM Subject: Re: LF: Ebnaut tonite from JN80 Rob, Jay, thank you so much, as always, for reports. Rob: QRB is 7048 km, congratulations!=20 It's a really excellent job. All the best 73 de Riccardo IW4DXW Il giorno Lun 28 Gen 2019, 13:20 Rob Renoud h= a scritto: Domenico and Riccardo, Riccardo: 1 Decode at 2300 UTC Rank 0; cEb/N0 3.2; Eb/N0 0.9; MSG 73, BER 38.7; Ref Phase 0,0,0,0 Domenico: Sorry, no decodes. 73, Rob On Jan 28, 2019, at 06:06, "jrusgrove@comcast.net" wrote: Domenico Sorry to report no decodes ;~( . Jay W1VD ----- Original Message ----- From: Domenico IZ7SLZ Reply-To: To: Sent: 1/27/2019 1:32:37 PM Subject: Re: LF: Ebnaut tonite from JN80 Rob, Jay, LF=20 Another attempt tonight. Same parameters (6 char, 3 s/sym, crc16, 8K19= A) Qrq is 137545.2 Hz=20 (The script is ok now!!) Every hour from 21.00 utc 'til=20 07 utc of tomortow) 73, Domenico IZ7SLZ=20 On 27 Jan 2019 15:25, "Rob Renoud" wrote: Domenico, No decodes as you were outside of my receive range. 73, Rob On Jan 27, 2019, at 05:27, Domenico IZ7SLZ = wrote: LF, my previous =20 transmission's announcement was wrong. Since i have run an obsolete setup file, the transmissions succeeded b= ut on 137540.0 Hz (instead of 137545.2 Hz) with 6 char, 3 s, 8K19A, CRC16. I hope that receiving attempts can be done anyway. Sorry for the troub= le. I will send now, via daytime propagation, an 'hope' message on 137540 = Hz, 38 characters 0.5 s/sym 8K19A, CRC16 at 10:30, 11:30, 12:30, 13:30. Finger crossed also for that situation ! 73, Domenico IZ7SLZ On Sun, 27 Jan 2019 at 00:24, Domenico IZ7SLZ wrote: Yes Markus, LF=20 Confirm: 6 characters. Apologies for the clerical error and thanks Markus for the advice. 73, Dom IZ7SLZ On Sat, 26 Jan 2019, 22:49 Markus Vester An: rsgb_lf_group Verschickt: Sa, 26. Jan. 2019 19:55 Betreff: LF: Ebnaut tonite from JN80 LF, Ebnauteers=20 An attempt to pass my complete call sign with EbNaut on 137545.2 Hz. 5 char, 3 s, 8K19A, CRC16, duration 28',=20 every hour from 21.00 UT to 08.00 UT of tomorrow. 73, Domenico IZ7SLZ --JYgHLPsSm64pKQmDp=_VYOHl5Ei5beZWnq Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline
Riccardo
 
Only two decodes last night. Note that DCF39 has been on the weak= side the past couple nights.
 
2300 Rank 249 car Eb/N0 0.0 dB Eb/N0 0.1 dB DXW-SDR
2330 -
0000 -
0030 -
0100 -
0130 -
0200  -
0230 -
0300 -
0330 Rank 1 car Eb/N0 0.8 dB Eb/N0 -0.2 dB *******
0400 -          = ;     
0430 -
0500 -
0530 -
0600 -
0630 -
 
And one decode from the previous night ... finally found your TX = schedule ;~) . 
 
0300 Rank 80 car Eb/N0 1.0 dB Eb/N0 -0.6 dB 73
 
Jay W1VD
 
 
----- Original Message -----
From: Riccardo Zoli <riccardozoli80@gmail.com>
Sent: 1/28/2019 4:21:19 PM
Subject: Re: LF: Ebnaut tonite from JN80

Jay, Domenico, LF

now it's raining and the antenna current it's quite unstable.
Anyway, tonite I'll try another TX session with a new Spectrum La= b configuration.
In particular, I'd simply use the aux out as "quadrature output f= or I/Q modulator" instead external HDSDR program and without VAC:


The image rejection optimization isn't possible by software but i= t's already quite good.
So:

QRG: 137546.2 Hz
Coding 8K19A
CRC 15
3 sec./sym
7 characters
Duration: 30 min.
Every 30 min., 1st on 2200z, last on 0700z

Many thanks.

All the best

73 de Riccardo IW4DXW


Il giorno Lun 28 Gen 2019, 20:45 <jrusgrove@comc= ast.net> ha scritto:
Riccardo
 
What was your transmission schedule l= ast night ... I must have missed it.
 
Jay W1VD
 
----- Original Message -----
From: Riccardo Zoli
Sent: Monday, January 28, 2019 = 1:22 PM
Subject: Re: LF: Ebnaut tonite = from JN80


Rob, Jay,

thank you so much, as always, for reports.
Rob: QRB is 7048 km, congratulations! It's a really excellent job= =2E

All the best

73 de Riccardo IW4DXW






Il giorno Lun 28 Gen 2019, 13:20 Rob Renoud <k3rwr@md.metrocast.net> ha scritto:
Domenico and Riccardo,

Riccardo:  1 Decode at 2300 UTC
Rank 0; cEb/N0 3.2; Eb/N0 0.9; MSG 73, BER 38.7; Ref Ph= ase 0,0,0,0

Domenico:  Sorry, no decodes.

73,
Rob

On Jan 28, 2019, at 06:06, "jrusgrove@comcast.net" <jrusgrove@comcast.net> wrote:

Domenico
 
Sorry to report no decodes ;~( .
 
Jay W1VD
 
 
----- Original Message -----
From: Domenico IZ7SLZ <iz7slz.domenico@gmail.com>
Sent: 1/27/2019 1:32:37 PM
Subject: Re: LF: Ebnaut tonite from JN80
Rob, Jay, LF=20

Another attempt tonight. Same parameters (6 char, 3 s/sym, crc16,= 8K19A)
Qrq is 137545.2 Hz 
(The script is ok now!!)
Every hour from 21.00 utc 'til 07 utc of tomortow)

73, Domenico IZ7SLZ 

On 27 Jan 2019 15:25, "Rob Renoud" <k3rwr@md.metrocast.net> wrote= :
Domenico,

No decodes as you were outside of my receive range.

73,
Rob

On Jan 27, 2019, at 05:27, Domenico IZ7SLZ <iz7slz.domenico@gmai= l.com> wrote:

LF,
my previous  transmission's announcement was wrong.

Since i have run an obsolete setup file, the transmissions succee= ded but on 137540.0 Hz  (instead of 137545.2 Hz) with 6
=
char, 3 s, 8K19A, CRC16.
I hope that receiving attempts can = be done anyway. Sorry for the trouble.

I will send now, via daytime propagation, an 'hope' message on 13= 7540 Hz, 38 characters 0.5 s/sym 8K19A, CRC16
at 10:30, 11:30, 12:30, 13:30.

Finger crossed also for that situation !

73, Domenico IZ7SLZ







On Sun, 27 Jan 2019 at 00:24, Domenico IZ7SLZ <iz7slz.domenico@gmail.com> = wrote:
Yes Markus, LF=20

Confirm: 6 characters.

Apologies for the clerical error and thanks Markus for the advice= =2E

73, Dom IZ7SLZ

On Sat, 26 Jan 2019, 22:49 Markus Vester <markusvester@aol.com wrote:=
Hi Domenico,

6 characters I would guess?
73, Markus


-----Urspr=C3=BCngliche Mitteilung-----
Von= : Domenico IZ7SLZ <iz7slz.domenico@gmail.com>
An: rsgb_lf_grou= p <rsgb_lf_group@blacksheep.org>
Verschickt: Sa, 26. Jan. 2= 019 19:55
Betreff: LF: Ebnaut tonite from JN80

LF, Ebnauteers=20

An attempt to pass my complete call sign with EbNaut on 137545.2 = Hz.

5 char, 3 s, 8K19A, CRC16, duration 28', every hour from 21.00 UT= to 08.00 UT of tomorrow.
73, Domenico IZ7SLZ

=
--JYgHLPsSm64pKQmDp=_VYOHl5Ei5beZWnq--