Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x0SBJ9V8016148 for ; Mon, 28 Jan 2019 12:19:15 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1go4ku-0005QL-IV for rs_out_1@blacksheep.org; Mon, 28 Jan 2019 11:07:08 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1go4kt-0005QC-Oc for rsgb_lf_group@blacksheep.org; Mon, 28 Jan 2019 11:07:07 +0000 Received: from resqmta-ch2-07v.sys.comcast.net ([2001:558:fe21:29:69:252:207:39]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1go4kr-00046D-6O for rsgb_lf_group@blacksheep.org; Mon, 28 Jan 2019 11:07:06 +0000 Received: from resomta-ch2-09v.sys.comcast.net ([69.252.207.105]) by resqmta-ch2-07v.sys.comcast.net with ESMTP id o4g1gyvg3XAATo4kmgDPO8; Mon, 28 Jan 2019 11:07:00 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1548673620; bh=uEVla7LdPbfKtspqSO4F2BtVPttPJrF0bKpbVBY+ZT8=; h=Received:Received:From:Subject:To:Content-Type:MIME-Version:Date: Message-ID; b=X31Gx63aYOXw3hnJ30ex/7kW0R+290kvX/vjypvglr9lWW1kzABjRISvogTNBTTT0 BXFhExcRtD4Lkq0hZ3QQTWef6mEBWbLtBf8ASHG7Oy6WohDPbl5/rTP6ikdcwRw01h e26+WDxA2aF6H2YYi8N8aYbHuYUdHhh4ayhRftAXLimsMRUNagq42k8TLD78gbm5TE tQUQVou067WDAkpvBvwDt+O9N0ASg+VtzvHGoZx8ZlHukkPKPnHRucceLUnLHFZAUk Y7+aCJOCtvTJEOSHCNKQq+yWEwUjcXKqv+gYghm0TBNhnrazyHcjhM53mWykhR1vAb eAsnZQRkIILgQ== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-09v.sys.comcast.net with ESMTPSA id o4klgjtOe9uako4klgDcKV; Mon, 28 Jan 2019 11:07:00 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtledrjedtgddvkecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddtnecuogfntfdquehouhhnugdqtfefvdculdehmdenucfjughrpefhuffvtgggfhffkfgjfgesrgdtreertderjeenucfhrhhomhepfdhjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtfdcuoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopefqphhtihhplhgvgielkedtqdfrvedpihhnvghtpeejfedrgedrvdehfedrudeguddpmhgrihhlfhhrohhmpehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtpdhrtghpthhtoheprhhsghgspghlfhgpghhrohhuphessghlrggtkhhshhgvvghprdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-Xfinity-VMeta: sc=5;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" MIME-Version: 1.0 References: <1690723859.1653766.1548539148821.ref@mail.yahoo.com> <1690723859.1653766.1548539148821@mail.yahoo.com> Date: Mon, 28 Jan 2019 06:06:58 -0500 Message-ID: <1UTCWet7ZZ.BO7EfIhLRDp@optiplex980-pc> In-Reply-To: User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: Domenico Sorry to report no decodes ;~( . Jay W1VD Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:39 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message X-Scan-Signature: 29f1b43ee9e13e220716185d38bfb88c Subject: Re: LF: Ebnaut tonite from JN80 Content-Type: multipart/alternative; boundary="dIbeXGM8LWNm2BLK0UwbKLqf0D1DRoy5=_" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: X-Spam-Status: No, hits=0.5 required=5.0 tests=HTML_40_50,HTML_MESSAGE, TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format --dIbeXGM8LWNm2BLK0UwbKLqf0D1DRoy5=_ Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline Domenico Sorry to report no decodes ;~( . Jay W1VD ----- Original Message ----- From: Domenico IZ7SLZ Reply-To: To: Sent: 1/27/2019 1:32:37 PM Subject: Re: LF: Ebnaut tonite from JN80 Rob, Jay, LF Another attempt tonight. Same parameters (6 char, 3 s/sym, crc16, 8K19= A) Qrq is 137545.2 Hz=20 (The script is ok now!!) Every hour from 21.00 utc=20 'til 07 utc of tomortow) 73, Domenico IZ7SLZ=20 On 27 Jan 2019 15:25, "Rob Renoud" wrote: Domenico, No decodes as you were outside of my receive range. 73, Rob On Jan 27, 2019, at 05:27, Domenico IZ7SLZ = wrote: LF, my previous transmission's=20 announcement was wrong. Since i have run an obsolete setup file, the transmissions succeeded b= ut on=20 137540.0 Hz (instead of 137545.2 Hz) with 6 char, 3 s, 8K19A, CRC16. I hope that receiving attempts can be done anyway. Sorry for the troub= le. I will send now, via daytime propagation, an 'hope' message on 137540 = Hz, 38=20 characters 0.5 s/sym 8K19A, CRC16 at 10:30, 11:30, 12:30, 13:30. Finger crossed also for that situation ! 73, Domenico IZ7SLZ On Sun, 27 Jan 2019 at 00:24, Domenico IZ7SLZ wrote: Yes Markus, LF Confirm: 6 characters. Apologies for the clerical error and thanks Markus for the advice. 73, Dom IZ7SLZ On Sat, 26 Jan 2019, 22:49 Markus Vester An: rsgb_lf_group Verschickt: Sa, 26. Jan. 2019 19:55 Betreff: LF: Ebnaut tonite from JN80 LF, Ebnauteers An attempt to pass my complete call sign with EbNaut on 137545.2 Hz. 5 char, 3 s, 8K19A, CRC16, duration 28', every hour from 21.00 UT to 0= 8.00 UT of tomorrow. 73, Domenico IZ7SLZ --dIbeXGM8LWNm2BLK0UwbKLqf0D1DRoy5=_ Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline
Domenico
 
Sorry to report no decodes ;~( .
 
Jay W1VD
 
 
----- Original Message -----
From: Domenico IZ7SLZ <iz7slz.domenico@gmail.com>
Sent: 1/27/2019 1:32:37 PM
Subject: Re: LF: Ebnaut tonite from JN80
Rob, Jay, LF

Another attempt tonight. Same parameters (6 char, 3 s/sym, crc16,= 8K19A)
Qrq is 137545.2 Hz 
(The script is ok now!!)
Every hour from 21.00 utc 'til 07 utc of tomortow)

73, Domenico IZ7SLZ 

On 27 Jan 2019 15:25, "Rob Renoud" <k3rwr@md.metrocast.net> wro= te:
Domenico,

No decodes as you were outside of my receive range.

73,
Rob

On Jan 27, 2019, at 05:27, Domenico IZ7SLZ <iz7slz.domenico@gmail.com> wrote:

LF,
my previous  transmission's announcement was wrong.

Since i have run an obsolete setup file, the transmissions succee= ded but on 137540.0 Hz  (instead of 137545.2 Hz) with 6
=
char, 3 s, 8K19A, CRC16.
I hope that receiving attempts can = be done anyway. Sorry for the trouble.

I will send now, via daytime propagation, an 'hope' message on 13= 7540 Hz, 38 characters 0.5 s/sym 8K19A, CRC16
at 10:30, 11:30, 12:30, 13:30.

Finger crossed also for that situation !

73, Domenico IZ7SLZ







On Sun, 27 Jan= 2019 at 00:24, Domenico IZ7SLZ <iz7slz.domenico@gmail.com<= /A>> wrote:
Yes Markus, LF

Confirm: 6 characters.

Apologies for the clerical error and thanks Markus for the advice= =2E

73, Dom IZ7SLZ

Hi Domenico,

6 characters I would guess?
73, Markus


-----Urspr=C3=BCngliche Mitteilung-----
Von= : Domenico IZ7SLZ <iz7slz.domenico@gmail.com>
An: rsgb_lf_group <rsgb_lf_group@= blacksheep.org>
Verschickt: Sa, 26. Jan. 2019 19:55
Betre= ff: LF: Ebnaut tonite from JN80

LF, Ebnauteers

An attempt to pass my complete call sign with EbNaut on 137545.2 = Hz.

5 char, 3 s, 8K19A, CRC16, duration 28', every hour from 21.00 UT= to 08.00 UT of tomorrow.
73, Domenico IZ7SLZ

=
--dIbeXGM8LWNm2BLK0UwbKLqf0D1DRoy5=_--