Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x0PBQbEU029492 for ; Fri, 25 Jan 2019 12:26:43 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gmzXf-0005gU-VT for rs_out_1@blacksheep.org; Fri, 25 Jan 2019 11:20:59 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gmzXf-0005gL-0V for rsgb_lf_group@blacksheep.org; Fri, 25 Jan 2019 11:20:59 +0000 Received: from resqmta-ch2-02v.sys.comcast.net ([2001:558:fe21:29:69:252:207:34]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1gmzXc-0000i8-9x for rsgb_lf_group@blacksheep.org; Fri, 25 Jan 2019 11:20:57 +0000 Received: from resomta-ch2-11v.sys.comcast.net ([69.252.207.107]) by resqmta-ch2-02v.sys.comcast.net with ESMTP id mzQrga6K19VLomzXWgNpSr; Fri, 25 Jan 2019 11:20:50 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1548415250; bh=J7XRcgVbdeMgEjKrPVd1OXb/A2Wjms5lC56QQDDKnzg=; h=Received:Received:From:Subject:To:Content-Type:MIME-Version:Date: Message-ID; b=FXrXfKxfYNNgOMHr6u6ANZBQiHh5i+h5RU0VTzyUQE44Rv5FisJn/ls4YwvA56B0S 04GeqSjd3CgEhGZnqwVUHacsSeZzi2n00pZ/ONwLoMOoD2xVNFYGNqC/LUbLiOir8O DtT8/Ox5wn2r3SNPkSmyiqV34o60BEtuTNTlrmvu/rQYxOVTzvM8wJErNk7Mwj65a4 U4c2TgG0QhDJ79+PEzNc8W6T0s154Y9jwwQP9H1W3tDRPjIaQ+D1S6udW37XSg7ywz usxV2+991hGgOsZdMoTrpA1yS9TfFwjXkZrlOSovkfE7FRhMmMFpLGkD1R/2n+SdZG fF1bY1hXh0ZcQ== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-11v.sys.comcast.net with ESMTPSA id mzXVgRw0p6FMCmzXVg3sqX; Fri, 25 Jan 2019 11:20:50 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtledrieeggddvkecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddtnecuogfntfdquehouhhnugdqtfefvdculdehmdenucfjughrpefhuffvtgggfhffkfgjfgesrgdtreertderjeenucfhrhhomhepfdhjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtfdcuoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopefqphhtihhplhgvgielkedtqdfrvedpihhnvghtpeejfedrgedrvdehfedrudeguddpmhgrihhlfhhrohhmpehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtpdhrtghpthhtoheprhhsghgspghlfhgpghhrohhuphessghlrggtkhhshhgvvghprdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-Xfinity-VMeta: sc=5;st=legit From: "jrusgrove@comcast.net" To: rsgb_lf_group@blacksheep.org MIME-Version: 1.0 References: Date: Fri, 25 Jan 2019 06:20:48 -0500 Message-ID: <1UTCTNxG9H.5T3bfQF3xD0@optiplex980-pc> In-Reply-To: User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Riccardo Better results last night. QRN levels were moderate but not as bad as the night before. 2300 - 2330 - 0000 - 0030 - 0100 - 0130 Rank 0 car Eb/N0 5.1 dB Eb/N0 3.2 dB *** 0200 Rank 0 car Eb/N0 6.3 dB Eb/N0 6.7 dB DXW 0230 Rank 0 car Eb/N0 6.6 dB Eb/N0 5.0 dB *** 0300 Rank 0 car Eb/N0 3.0 d [...] Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:34 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: e5f33499c82e559d1cf2f25253946608 Subject: Re: LF: EbNaut tonite Content-Type: multipart/alternative; boundary="b=_9nCechGxdeS4YYC8VJbvggcEGHNFSPX" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: * X-Spam-Status: No, hits=1.5 required=5.0 tests=HTML_40_50,HTML_MESSAGE, MAILTO_TO_SPAM_ADDR autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format --b=_9nCechGxdeS4YYC8VJbvggcEGHNFSPX Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline Riccardo Better results last night. QRN levels were moderate but not as bad as = the night=20 before. 2300 - 2330 - 0000 - 0030 - 0100 - 0130 Rank 0 car Eb/N0 5.1 dB Eb/N0 3.2 dB *** 0200 Rank 0 car Eb/N0 6.3 dB Eb/N0 6.7 dB DXW 0230 Rank 0 car Eb/N0 6.6 dB Eb/N0 5.0 dB *** 0300 Rank 0 car Eb/N0 3.0 dB Eb/N0 2.5 dB DXW 0330 Rank 0 car Eb/N0 2.2 dB Eb/N0 1.0 dB *** 0400 - 0430 - 0500 - 0530 - 0600 - 0630 - Jay W1VD ----- Original Message -----=20 From: Riccardo Zoli=20 To: LF Group=20 Sent: Thursday, January 24, 2019 4:08 PM Subject: Re: LF: EbNaut tonite Jay, Rob, LF Ok, many thanks! I understand the high noise last night. Rob: my QRG may be almost exactly 137545 Hz, with probably minor varia= tions (at=20 least a few hundred of uHz) due to=20 propagation's doppler effect near the terminator. Now I'm on air with an=20 unmodulated carrier on the same QRG, then: QRG: 137545 Hz Coding 8K19A CRC 12 5 sec./sym. 3 characters no time delay duration: 32 min. Message repeated hourly, 1st on 2200z, last on 0700z. Unmodulated carrier from xx:32 to xx:00 minute. Reports are welcome (noise permitting). All the best 73 de Riccardo IW4DXW --b=_9nCechGxdeS4YYC8VJbvggcEGHNFSPX Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline
Riccardo
 
Better results last night. QRN levels were moderate but= not as bad as the night before.
 
2300 -
2330 -
0000 -
0030 -
0100 -
0130 Rank 0 car Eb/N0 5.1 dB Eb/N0 3.2 dB ***
0200 Rank 0 car Eb/N0 6.3 dB Eb/N0 6.7 dB DXW
0230 Rank 0 car Eb/N0 6.6 dB Eb/N0 5.0 dB ***
0300 Rank 0 car Eb/N0 3.0 dB Eb/N0 2.5 dB DXW
0330 Rank 0 car Eb/N0 2.2 dB Eb/N0 1.0 dB ***
0400 -
0430 -
0500 -
0530 -
0600 -
0630 -
 
Jay W1VD
 
 
----- Original Message -----=20
Sent: Thursday, January 24, 2019 4:08 PM
Subject: Re: LF: EbNaut tonite


Jay, Rob, LF


Ok, many thanks! I understand the high noise last night.
Rob: my QRG may be almost exactly 137545 Hz, with probably minor = variations (at least a few hundred of uHz) due to propagation's dopple= r effect near the terminator.
Now I'm on air with an unmodulated carrier on the same QRG, then:=

QRG: 137545 Hz
Coding 8K19A
CRC 12
5 sec./sym.
3 characters
no time delay
duration: 32 min.

Message repeated hourly, 1st on 2200z, last on 0700z.

Unmodulated carrier from xx:32 to xx:00 minute.

<= /DIV>
Reports are welcome (noise permitting).


All the best

73 de Riccardo IW4DXW
--b=_9nCechGxdeS4YYC8VJbvggcEGHNFSPX--