Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x0NBNluu017371 for ; Wed, 23 Jan 2019 12:23:53 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gmGXo-0007CU-Bm for rs_out_1@blacksheep.org; Wed, 23 Jan 2019 11:18:08 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gmGXn-0007CL-Kp for rsgb_lf_group@blacksheep.org; Wed, 23 Jan 2019 11:18:07 +0000 Received: from resqmta-ch2-03v.sys.comcast.net ([2001:558:fe21:29:69:252:207:35]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1gmGXk-00041m-OP for rsgb_lf_group@blacksheep.org; Wed, 23 Jan 2019 11:18:06 +0000 Received: from resomta-ch2-18v.sys.comcast.net ([69.252.207.114]) by resqmta-ch2-03v.sys.comcast.net with ESMTP id mGV6gbkQ1xz2zmGXfgKZbn; Wed, 23 Jan 2019 11:17:59 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1548242279; bh=PszmnQx0WRALdcfMaX0tJUEr0wG41FFas4idtpB07TY=; h=Received:Received:From:Subject:To:Content-Type:MIME-Version:Date: Message-ID; b=g5/SzFwibpmqnBOwTy1XSoeyI2F20zbycsot3u0//aRe9lvI5dINliK9QQakcWvCS lsJxvm3b5hCXQUWId40vdFFKKq2mt7i52E0bGeDXQrwRscwy9ooAv74olXJUUDXB7v iA0QVR9vIpz0W8pK8bGpyyGnHgfMFhiDHd2GDgn+IeV76Et5vhrlyKqc/i7MshtnuM YLUFXcZLH4j6PuDaHQncgv9R1OK19C1w0Hy5/3g7pyKn7Mgh3jFGBlU/vEpkiwUIcH jjOh8pY6fuXVVo3xFoZz5xql5pUeSl2Hp8tWZeaLWfpjaoLWvlUPRuTqug+zpaN6Jd xU5K+p4iXRo9A== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-18v.sys.comcast.net with ESMTPSA id mGXdgjNul3zz9mGXegXzcK; Wed, 23 Jan 2019 11:17:58 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtledriedtgddvjecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddtnecuogfntfdquehouhhnugdqtfefvdculdehmdenucfjughrpefhuffvtgggfhffkfgjfgesrgdtreertderjeenucfhrhhomhepfdhjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtfdcuoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopefqphhtihhplhgvgielkedtqdfrvedpihhnvghtpeejfedrgedrvdehfedrudeguddpmhgrihhlfhhrohhmpehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtpdhrtghpthhtoheprhhsghgspghlfhgpghhrohhuphessghlrggtkhhshhgvvghprdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-Xfinity-VMeta: sc=5;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" MIME-Version: 1.0 References: <1541712573053.31739@kuleuven.be> <5C3F2E54.1080204@posteo.de> <5C44B472.9090901@posteo.de> <1UTCP1TTXz.GTBnkuWTAJs@optiplex980-pc> <1UTCP1tymN.HCrj4Hc5Ogz@optiplex980-pc> <8B74554DD9CC447AA7826347ACFA2369@DELL4> Date: Wed, 23 Jan 2019 06:17:57 -0500 Message-ID: <1UTCRCaEyH.MEMhnQf8VB0@optiplex980-pc> In-Reply-To: User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Riccardo Late start last night (0000z). Unfortunately no decodes. There were numerous low Rank false decodes ... not sure what's up with that! Jay W1VD Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:35 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: e145a4cc3b6fd6b4167a090b344183b7 Subject: Re: LF: EbNaut tonite Content-Type: multipart/alternative; boundary="d3HZQYU773mCnLU8w5JooZRVltqOLBo=_d" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: * X-Spam-Status: No, hits=1.5 required=5.0 tests=HTML_40_50,HTML_MESSAGE, MAILTO_TO_SPAM_ADDR,TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format --d3HZQYU773mCnLU8w5JooZRVltqOLBo=_d Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline Riccardo Late start last night (0000z). Unfortunately no decodes. There were nu= merous=20 low Rank false decodes ... not sure what's up with that! Jay W1VD ----- Original Message ----- From: Riccardo Zoli Reply-To: To: LF Group Sent: 1/22/2019 2:48:00 PM Subject: Re: LF: EbNaut tonite Sorry: message repeated every 30 minutes. 73, Riccardo IW4DXW Il giorno Mar 22 Gen 2019, 20:15 Riccardo Zoli ha scritto: Jay, Rob, LF QRG 137545 Hz Coding 8K19A CRC 8 3 sec./sym. 8 characters duration 29 min. 36 sec. no time delay (1st on 1930 UTC, last on 0700 UTC) Reports are welcome All the best 73 de Riccardo IW4DXW Il giorno Lun 21 Gen 2019, 23:03 ha scritto: Riccardo Glad to hear you found the problem. Will await your announcement and l= ook for your signal tomorrow night. Jay W1VD ----- Original Message -----=20 From: Riccardo Zoli=20 To: LF Group=20 Sent: Monday, January 21, 2019 4:13 PM Subject: Re: LF: EbNaut tonite Jay, Rob, Markus, Stefan, Joe, LF Jay, thanks again for the decode: congrats for your rx setup. And thank you so much for trying, Rob. Here, the TP2 reference signal (not sufficiently filtered) overshot so= metimes the quadrature divider (x4) causing that phase jumps. The prob= lem is now fixed. A new TX EbNaut session is scheduled for starting tomorrow evening. All the best 73 de Riccardo IW4DXW Il giorno Lun 21 Gen 2019, 13:20 jrusgrove@comcast.net ha scritto: Riccardo Corrected decode: 0300 Rank 0 car Eb/N0 2.3 Eb/N0 1.4 FBDECODE Jay W1VD ----- Original Message ----- From: Reply-To: To: Sent: 1/21/2019 6:53:39 AM Subject: Re: LF: EbNaut tonite Stefan, Riccardo & EbNaut-eers Stefan ... good copy throughout the night. Riccardo ... unfortunately = only one decode to report. Markus noted a frequency error ... curious = if propagation or NE0-M8T?=20 137545 2200 Rank 0 car Eb/N0 9.5 Eb/N0 9.2 RADIO GAGA 2300 - 0000 Rank 0 car Eb/N0 9.2 Eb/N0 9.3 RADIO GAGA 0100 Rank 0 car Eb/N0 6.0 Eb/N0 6.0 RADIO GAGA 0200 Rank 0 car Eb/N0 5.3 Eb/N0 5.9 RADIO GAGA 0300 Rank 0 car Eb/N0 6.1 Eb/N0 6.8 RADIO GAGA 0400 Rank 0 car Eb/N0 11.3 Eb/N0 10.4 RADIO GAGA 0500 Rank 0 car Eb/N0 3.7 Eb/N0 4.6 RADIO GAGA 0600 Rank 0 car Eb/N0 10.6 Eb/N0 10.2 RADIO GAGA 137547 0300 Rank 0 car Eb/N0 10.0 Eb/N0 FBDECODE Jay W1VD ----- Original Message ----- From: DK7FC Reply-To: To: Sent: 1/20/2019 12:48:34 PM Subject: LF: EbNaut tonite LF,=20 Tonite: f =3D 137.545 kHz Start time: 20.JAN.2019 22:00:00.3 UTC (hourly, including 6 UTC) Symbol period: 1 s Characters: 10 CRC bits: 12 Coding 16K21A Antenna current: 4 A Duration: 24:32 [mm:ss] 73, Stefan --d3HZQYU773mCnLU8w5JooZRVltqOLBo=_d Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline
Riccardo
 
Late start last night (0000z). Unfortunately no decodes. There we= re numerous low Rank false decodes ... not sure what's up with that!
 
Jay W1VD
 
 
----- Original Message -----
From: Riccardo Zoli <riccardozoli80@gmail.com>
Sent: 1/22/2019 2:48:00 PM
Subject: Re: LF: EbNaut tonite

Sorry: message repeated every 30 minutes.

73, Riccardo IW4DXW

Il giorno Mar 22 Gen 2019, 20:15 Riccardo Zoli <riccardozoli80@gmail.com&g= t; ha scritto:

Jay, Rob, LF

QRG 137545 Hz
Coding 8K19A
CRC 8
3 sec./sym.
8 characters
duration 29 min. 36 sec.
no time delay
(1st on 1930 UTC, last on 0700 UTC)

Reports are welcome


All the best

73 de Riccardo IW4DXW



Il giorno Lun 21 Gen 2019, 23:03 <j= rusgrove@comcast.net> ha scritto:
Riccardo
 
Glad to hear you found the problem. W= ill await your announcement and look for your signal tomorrow night.
 
Jay W1VD
----- Original Message -----
Sent: Monday, January 21, 2019 = 4:13 PM
Subject: Re: LF: EbNaut tonite<= /DIV>


Jay, Rob, Markus, Stefan, Joe, LF


Jay, thanks again for the decode: congrats for your rx setup.
And thank you so much for trying, Rob.

Here, the TP2 reference signal (not sufficiently filtered) oversh= ot sometimes the quadrature divider (x4) causing that phase jumps. The= problem is now fixed.

A new TX EbNaut session is scheduled for starting tomorrow evenin= g.

All the best


73 de Riccardo IW4DXW







Il giorno Lun 21 Gen 2019, 13:20 jrusgrove@comcast.net <jrusgrove@comcast.net> ha scritto:
Riccardo
 
Corrected decode:
 
0300 Rank 0 car Eb/N0 2.3 Eb/N0 1.4 FBDECODE
=
 
Jay W1VD
 
 
 
----- Original Message -----
Sent: 1/21/2019 6:53:39 AM
Subject: Re: LF: EbNaut tonite
Stefan, Riccardo & EbNaut-eers
 
 
Stefan ... good copy throughout the night. Riccardo ... unfortuna= tely only one decode to report. Markus noted a frequency error ..= =2E curious if propagation or NE0-M8T?
 
 
137545
 
2200 Rank 0 car Eb/N0 9.5 Eb/N0 9.2 RADIO GAGA
2300 -
0000 Rank 0 car Eb/N0 9.2 Eb/N0 9.3 RADIO GAGA
0100 Rank 0 car Eb/N0 6.0 Eb/N0 6.0 RADIO GAGA
0200 Rank 0 car Eb/N0 5.3 Eb/N0 5.9 RADIO GAGA
0300 Rank 0 car Eb/N0 6.1 Eb/N0 6.8 RADIO GAGA
0400 Rank 0 car Eb/N0 11.3 Eb/N0 10.4 RADIO GAGA
0500 Rank 0 car Eb/N0 3.7 Eb/N0 4.6 RADIO GAGA
0600 Rank 0 car Eb/N0 10.6 Eb/N0 10.2 RADIO GAGA
 
 
137547
 
0300 Rank 0 car Eb/N0 10.0 Eb/N0  FBDECODE
 
Jay W1VD
 
 
 
 
 
 
----- Original Message -----
Sent: 1/20/2019 12:48:34 PM
Subject: LF: EbNaut tonite
LF,

Tonite:

f =3D 137.545 kHz
Start time: 20.JAN.= 2019  22:00:00.3 UTC (hourly, including 6 UTC)
Symbol period: = 1 s
Characters: 10
CRC bits: 12
Coding 16K21A
A= ntenna current: 4 A
Duration: 24:32 [mm:ss]


73, Stef= an
<= /BODY> --d3HZQYU773mCnLU8w5JooZRVltqOLBo=_d--