Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x0LBxfUr004845 for ; Mon, 21 Jan 2019 12:59:49 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1glY9G-000678-Je for rs_out_1@blacksheep.org; Mon, 21 Jan 2019 11:53:50 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1glY9D-00066z-TR for rsgb_lf_group@blacksheep.org; Mon, 21 Jan 2019 11:53:47 +0000 Received: from resqmta-ch2-11v.sys.comcast.net ([2001:558:fe21:29:69:252:207:43]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1glY9A-0007dP-Uo for rsgb_lf_group@blacksheep.org; Mon, 21 Jan 2019 11:53:46 +0000 Received: from resomta-ch2-09v.sys.comcast.net ([69.252.207.105]) by resqmta-ch2-11v.sys.comcast.net with ESMTP id lY1BgkrucMwIMlY97gP8wx; Mon, 21 Jan 2019 11:53:41 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1548071621; bh=5lx3oHcoec9vxgkLAFaPlJHXf4Q/0Za2DeQGPmjk7Tc=; h=Received:Received:From:Subject:To:Content-Type:MIME-Version:Date: Message-ID; b=DKkaMh1TxuKgAHd6lNxSwsQ2DRItExcbTjuJVPA1Fz1lNWHvDSa3wPy0HyUC9lHnN TZ2I9QwDP9RNznl9Up0lcYKmAdsXBuSZdvvkBK98cbmYw38SrtWnqkTdhZexWjt6T9 0lhJ5XPljaVlNH54iB0KJxIEFAcLclMFRbk5ZmihCRfJ0m2NjyUTGJGZoHCv/tNTTA l/22gjNEl/1JhU7pHZC62FfLKzXbo1hJVtxg09xGGlGwf+usKSMjOjyTD9Geg9MWbE hL5nwewvKts5i/zlVA+W9mnIESUiZTqgyxuMwMsKU4lgLBfoZhPNKP2xL7AjO6y9xl XcV7Z1rNVq8tw== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-09v.sys.comcast.net with ESMTPSA id lY96ggD8VssVRlY96gdhxG; Mon, 21 Jan 2019 11:53:41 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtledrheeigdefvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddtnecuogfntfdquehouhhnugdqtfefvdculdehmdenucfjughrpefhuffvtgggfhffkfgjfgesrgdtreertderjeenucfhrhhomhepfdhjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtfdcuoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopefqphhtihhplhgvgielkedtqdfrvedpihhnvghtpeejfedrgedrvdehfedrudeguddpmhgrihhlfhhrohhmpehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtpdhrtghpthhtoheprhhsghgspghlfhgpghhrohhuphessghlrggtkhhshhgvvghprdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" MIME-Version: 1.0 References: <1541712573053.31739@kuleuven.be> <1577921AD94DD17B.1915@groups.io> <1547497870081.57956@kuleuven.be> <5C3CFB7E.2010605@posteo.de> <5C3CFC32.9030509@posteo.de> <5C3E51A1.9020702@posteo.de> <5C3F2E54.1080204@posteo.de> <5C44B472.9090901@posteo.de> Date: Mon, 21 Jan 2019 06:53:39 -0500 Message-ID: <1UTCP1TTXz.GTBnkuWTAJs@optiplex980-pc> In-Reply-To: <5C44B472.9090901@posteo.de> User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Stefan, Riccardo & EbNaut-eers Stefan ... good copy throughout the night. Riccardo ... unfortunately only one decode to report. Markus noted a frequency error ... curious if propagation or NE0-M8T? 137545 Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:43 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: 131286aabc28dd54c072e5e89638c651 Subject: Re: LF: EbNaut tonite Content-Type: multipart/alternative; boundary="M5aS14a=_DCdvpyXUQDHlFpIeTRPpBX097" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: X-Spam-Status: No, hits=0.8 required=5.0 tests=HTML_30_40,HTML_MESSAGE, TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format --M5aS14a=_DCdvpyXUQDHlFpIeTRPpBX097 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline Stefan, Riccardo & EbNaut-eers Stefan ... good copy throughout the night. Riccardo ... unfortunately = only one=20 decode to report. Markus noted a frequency error ... curious if propag= ation or=20 NE0-M8T?=20 137545 2200 Rank 0 car Eb/N0 9.5 Eb/N0 9.2 RADIO GAGA 2300 - 0000 Rank 0 car Eb/N0 9.2 Eb/N0 9.3 RADIO GAGA 0100 Rank 0 car Eb/N0 6.0 Eb/N0 6.0 RADIO GAGA 0200 Rank 0 car Eb/N0 5.3 Eb/N0 5.9 RADIO GAGA 0300 Rank 0 car Eb/N0 6.1 Eb/N0 6.8 RADIO GAGA 0400 Rank 0 car Eb/N0 11.3 Eb/N0 10.4 RADIO GAGA 0500 Rank 0 car Eb/N0 3.7 Eb/N0 4.6 RADIO GAGA 0600 Rank 0 car Eb/N0 10.6 Eb/N0 10.2 RADIO GAGA 137547 0300 Rank 0 car Eb/N0 10.0 Eb/N0 FBDECODE Jay W1VD ----- Original Message ----- From: DK7FC Reply-To: To: Sent: 1/20/2019 12:48:34 PM Subject: LF: EbNaut tonite LF,=20 Tonite: f =3D 137.545 kHz Start time: 20.JAN.2019 22:00:00.3 UTC (hourly, including 6 UTC) Symbol period: 1 s Characters: 10 CRC bits: 12 Coding 16K21A Antenna current: 4 A Duration: 24:32 [mm:ss] 73, Stefan --M5aS14a=_DCdvpyXUQDHlFpIeTRPpBX097 Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline
Stefan, Riccardo & EbNaut-eers
 
 
Stefan ... good copy throughout the night. Riccardo ... unfortuna= tely only one decode to report. Markus noted a frequency error ..= =2E curious if propagation or NE0-M8T?
 
 
137545
 
2200 Rank 0 car Eb/N0 9.5 Eb/N0 9.2 RADIO GAGA
2300 -
0000 Rank 0 car Eb/N0 9.2 Eb/N0 9.3 RADIO GAGA
0100 Rank 0 car Eb/N0 6.0 Eb/N0 6.0 RADIO GAGA
0200 Rank 0 car Eb/N0 5.3 Eb/N0 5.9 RADIO GAGA
0300 Rank 0 car Eb/N0 6.1 Eb/N0 6.8 RADIO GAGA
0400 Rank 0 car Eb/N0 11.3 Eb/N0 10.4 RADIO GAGA
0500 Rank 0 car Eb/N0 3.7 Eb/N0 4.6 RADIO GAGA
0600 Rank 0 car Eb/N0 10.6 Eb/N0 10.2 RADIO GAGA
 
 
137547
 
0300 Rank 0 car Eb/N0 10.0 Eb/N0  FBDECODE
 
Jay W1VD
 
 
 
 
 
 
----- Original Message -----
Sent: 1/20/2019 12:48:34 PM
Subject: LF: EbNaut tonite
LF,

Tonite:

f =3D 137.545 kHz
Start time: 20.JAN.= 2019  22:00:00.3 UTC (hourly, including 6 UTC)
Symbol period: = 1 s
Characters: 10
CRC bits: 12
Coding 16K21A
A= ntenna current: 4 A
Duration: 24:32 [mm:ss]


73, Stef= an
--M5aS14a=_DCdvpyXUQDHlFpIeTRPpBX097--