Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x0KM8dNJ001076 for ; Sun, 20 Jan 2019 23:08:46 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1glL5a-0000IV-2w for rs_out_1@blacksheep.org; Sun, 20 Jan 2019 21:57:10 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1glL0e-0000IA-PY for rsgb_lf_group@blacksheep.org; Sun, 20 Jan 2019 21:52:04 +0000 Received: from resqmta-ch2-02v.sys.comcast.net ([2001:558:fe21:29:69:252:207:34]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1glL0U-0006Es-MX for rsgb_lf_group@blacksheep.org; Sun, 20 Jan 2019 21:51:59 +0000 Received: from resomta-ch2-06v.sys.comcast.net ([69.252.207.102]) by resqmta-ch2-02v.sys.comcast.net with ESMTP id lKibgUR3Y9VLolL0PgC7cu; Sun, 20 Jan 2019 21:51:49 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1548021109; bh=cDqGizXjzBVVOaVv44TsVlIOrrtKYPJXmsYG436o/RI=; h=Received:Received:From:Subject:To:Content-Type:MIME-Version:Date: Message-ID; b=oIQxH6sc6EKP6fv6C0XAGkNWAB9oH4el7Qyf3We2gsuEDevRIo7VH1Nq5PEekyJnK dsWVzZSzZ2uyHHu1TNOcl/3sLy8+6nvcP2f2tO8nmZZp8JcTQv1qG8aOA4n/ZHmQO+ dGw+XjXsrFKPhPP38LtoGPKD9+A3Wx5qVKCFS9FIa+W4VbEUWabrHw0/IRmAw9EH44 gfRD6im5Qc8+CwsoTydTQ6Bp58HlFwN4VJNTPjBEfgBC/2gVml9rxapxlSLJ8VZnIU RK4HyWy8wlbl+nxhqagjoOhwxofOg25UkFNlDMxw7fxjkh2JzfVyiAsxr4yefWl61q J/MBGSuQmC7IQ== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-06v.sys.comcast.net with ESMTPSA id lL0NgUesPksNmlL0OgnPsP; Sun, 20 Jan 2019 21:51:48 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtledrheeggdduheejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuvehomhgtrghsthdqtfgvshhipdfqfgfvpdfpqffurfetoffkrfenuceurghilhhouhhtmecufedttdenucgonfftqdeuohhunhguqdftfedvucdlhedmnecujfgurhephffuvfgtgghffffkjggfsegrtderredtreejnecuhfhrohhmpedfjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdfuceojhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvtheqnecukfhppeejfedrgedrvdehfedrudegudenucfrrghrrghmpehhvghlohepqfhpthhiphhlvgigleektddqrfevpdhinhgvthepjeefrdegrddvheefrddugedupdhmrghilhhfrhhomhepjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdprhgtphhtthhopehrshhgsggplhhfpghgrhhouhhpsegslhgrtghkshhhvggvphdrohhrghenucevlhhushhtvghrufhiiigvpedt X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" Subject: Re: LF: EbNaut tonite To: "rsgb_lf_group@blacksheep.org" Content-Type: multipart/alternative; boundary="cFANFEgQMmj1k5I6MWVek=_ZIhEtPlaIoL" MIME-Version: 1.0 References: <1541712573053.31739@kuleuven.be> <5C3CFB7E.2010605@posteo.de> <5C3CFC32.9030509@posteo.de> <5C3E51A1.9020702@posteo.de> <5C3F2E54.1080204@posteo.de> <5C44B472.9090901@posteo.de> <18DAC346-BD2D-4848-B510-DA3432FCBEB1@md.metrocast.net> Date: Sun, 20 Jan 2019 16:51:47 -0500 Message-ID: <1UTCO2YMMA.FXoBherIG0b@optiplex980-pc> In-Reply-To: User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: EbNaut enthusiasts Looking for Riccardo and Stefan ... and anyone else that might want to join in. Riccardo ... has your phase jump problem been corrected? Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:34 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: f9bb43a66658129469273581af35b296 X-SA-Exim-Scanned: No; SA Timed out after 180 secs Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format --cFANFEgQMmj1k5I6MWVek=_ZIhEtPlaIoL Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline EbNaut enthusiasts Looking for Riccardo and Stefan ... and anyone else that might want to= join in. Riccardo ... has your phase jump problem been corrected? Jay W1VD ----- Original Message ----- From: Riccardo Zoli Reply-To: To: LF Group Sent: 1/20/2019 2:16:49 PM Subject: Re: LF: EbNaut tonite Sorry, +2 Hz I think it's more adequate. What say you? So, correction:= QRG: 137547 Hz 73 de Riccardo IW4DXW Il giorno Dom 20 Gen 2019, 20:08 Riccardo Zoli ha scritto: Rob, Jay, Stefan, LF I could try side by side with Stefan on 137546 Hz coding 8K19A CRC 8 3 sec./sym. 8 characters duration 29 min. 36 sec. (every 30 min., 1st tx on 2000z, last on 0700z) Many thanks. 73 de Riccardo IW4DXW Il 20 Gen 2019 19:52, "Rob Renoud" ha scritto= : Stefan, I=E2=80=99ll be listening tonight. Bandwidth +/- 3 Hz from center fre= quency of 137545 Hz if others wish to join in. 73, Rob - K3RWR On Jan 20, 2019, at 12:48, DK7FC wrote: LF,=20 Tonite: f =3D 137.545 kHz Start time: 20.JAN.2019 22:00:00.3 UTC (hourly, including 6 UTC) Symbol period: 1 s Characters: 10 CRC bits: 12 Coding 16K21A Antenna current: 4 A Duration: 24:32 [mm:ss] 73, Stefan --cFANFEgQMmj1k5I6MWVek=_ZIhEtPlaIoL Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline
EbNaut enthusiasts
 
Looking for Riccardo and Stefan ... and anyone else that might wa= nt to join in.
 
Riccardo ... has your phase jump problem been corrected?
 
Jay W1VD
 
 
----- Original Message -----
From: Riccardo Zoli <riccardozoli80@gmail.com>
Sent: 1/20/2019 2:16:49 PM
Subject: Re: LF: EbNaut tonite

Sorry, +2 Hz I think it's more adequate. What say you? So,= correction:

QRG: 137547 Hz


73 de Riccardo IW4DXW


Il giorno Dom 20 Gen 2019, 20:08 Riccardo Zoli <riccardozoli80@gmail.com> ha scritto:

Rob, Jay, Stefan, LF

I could try side by side with Stefan on
 
137546 Hz
coding 8K19A
CRC 8
3 sec./sym.
8 characters
duration 29 min. 36 sec.
(every 30 min., 1st tx on 2000z, last on 0700z)

Many thanks.

73 de Riccardo IW4DXW





Il 20 Gen 2019 19:52, "Rob Renoud" <k3rwr@md.metrocast.net> ha scritto:
Stefan,

I=E2=80=99ll be listening tonight.  Bandwidth +/- = 3 Hz from center frequency of 137545 Hz if others wish to join in.

73,
Rob - K3RWR

On Jan 20, 2019, at 12:48, DK7FC <selberdenken@posteo.de> wrote:
LF,

Tonite:

f =3D 137.545 kHz
Star= t time: 20.JAN.2019  22:00:00.3 UTC (hourly, including 6 UTC)
= Symbol period: 1 s
Characters: 10
CRC bits: 12
Cod= ing 16K21A
Antenna current: 4 A
Duration: 24:32 [mm:ss]
<= BR>
73, Stefan

--cFANFEgQMmj1k5I6MWVek=_ZIhEtPlaIoL--