Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x0KEW0xJ031444 for ; Sun, 20 Jan 2019 15:32:06 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1glE1I-0005dY-7i for rs_out_1@blacksheep.org; Sun, 20 Jan 2019 14:24:16 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1glE0x-0005dP-AO for rsgb_lf_group@blacksheep.org; Sun, 20 Jan 2019 14:23:55 +0000 Received: from resqmta-ch2-02v.sys.comcast.net ([2001:558:fe21:29:69:252:207:34]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1glE0t-0005Wy-5Q for rsgb_lf_group@blacksheep.org; Sun, 20 Jan 2019 14:23:54 +0000 Received: from resomta-ch2-11v.sys.comcast.net ([69.252.207.107]) by resqmta-ch2-02v.sys.comcast.net with ESMTP id lDu1gU2o29VLolE0ogBG93; Sun, 20 Jan 2019 14:23:46 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1547994226; bh=uLnvgwgPGTrjwjMctS64I0SH9hlhpMp4eYeBNC5Gf2c=; h=Received:Received:From:Subject:To:Content-Type:MIME-Version:Date: Message-ID; b=ND2e+A1KZkynqQMtm6/2MTCZ9Tj0WGWKTDn40ZALC8pkIN30gmo0gJTU57RnDFMmC gs/j5fJPQ8iFMjMcnVujn7jgqbsJ6/DG8Xttvtl1Mmu6Kz7zNtkDruHMWzYOzXwcz8 gS0YUCFFC5lGRlEUEnilWlRuBbdZzeYF5LkvgP8YiYZuLXn78sB6N2v/HXjJH2mnn7 t4xb+7S5KpEVNLj+qXFWXMTC3Wc8P33QAIEQEhyboDahytu4fkyfSwALDs1xfXoFmi ueFuPRHPf6qNyhJTkREYPhTbmnGFWg7nkhJcxvukyU7r4PWXDeWQZuxhDFO4IhquH3 nz5l2SP2KWI3Q== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-11v.sys.comcast.net with ESMTPSA id lE0mg81B0aGzLlE0ngtNdg; Sun, 20 Jan 2019 14:23:45 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtledrheeggdeijecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddtnecuogfntfdquehouhhnugdqtfefvdculdehmdenucfjughrpefhuffvtgggfhffkfgjfgesrgdtreertderjeenucfhrhhomhepfdhjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtfdcuoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopefqphhtihhplhgvgielkedtqdfrvedpihhnvghtpeejfedrgedrvdehfedrudeguddpmhgrihhlfhhrohhmpehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtpdhrtghpthhtoheprhhsghgspghlfhgpghhrohhuphessghlrggtkhhshhgvvghprdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" MIME-Version: 1.0 References: <1UTCMpy6DA.3Qa4W73pIAl@optiplex980-pc> <1UTCNvcKZO.AI7JqK0W4Ih@optiplex980-pc> Date: Sun, 20 Jan 2019 09:23:44 -0500 Message-ID: <1UTCNxct0t.CaRR3zPvc1D@optiplex980-pc> In-Reply-To: User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Riccardo Will be interesting to try again once the phase jump problem is resolved. Very good results considering antenna and 300 watts! Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:34 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: 852e9a9ee930056348c0102e6df31911 Subject: Re: LF: EbNaut Content-Type: multipart/alternative; boundary="Yyg=_6OEIoa98e6DJqci1HdameIA5rg1VH" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: * X-Spam-Status: No, hits=1.5 required=5.0 tests=HTML_40_50,HTML_MESSAGE, MAILTO_TO_SPAM_ADDR,TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format --Yyg=_6OEIoa98e6DJqci1HdameIA5rg1VH Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline Riccardo Will be interesting to try again once the phase jump problem is resolv= ed. Very good results considering antenna and 300 watts! Jay W1VD ----- Original Message ----- From: Riccardo Zoli Reply-To: To: LF Group Sent: 1/20/2019 9:04:07 AM Subject: Re: LF: EbNaut Jay and Rob, thank you again for your efforts (and patience) to receive my signal a= cross the=20 pond. Thanks also to Stefan and Michel for the plots: I think the undesidere= d phase=20 jumps problem still not fully resolved here. So, good job, Jay! My antenna is an inverted "L" (12m. heigh, 36m. lon= g) fed=20 near the top with about 300W. All the best 73 de Riccardo IW4DXW Il giorno Dom 20 Gen 2019, 13:50 Rob Renoud h= a scritto: Riccardo and Jay, Great to see you made the TA connection! No decodes here unfortunatel= y. Rob - K3RWR On Jan 20, 2019, at 06:26, "jrusgrove@comcast.net" =20 wrote: Riccardo Better results last night ... congratulations on 4 decodes! What is y= ou power=20 and antenna? 2200 - 2230 - 2300 - 2330 -=20 0000 - 0030 -=20 0100 Rank 1 car Eb/N0 1.3 dB Eb/N0 1.1 dB IW4DXW 0130 - 0200 Rank 2067 car Eb/N0 0.7 dB Eb/N0 0.1 dB IW4DXW 0230 - 0300 - 0330 Rank 0 car Eb/N0 4.6 dB Eb/N0 4.5 dB IW4DXW 0400 - 0430 Rank 284 car Eb/N0 -0.2 dB Eb/N0 -1.2 dB IW4DXW 0500 - 0530 - 0600 - 0630 - Jay W1VD ----- Original Message ----- From: Riccardo Zoli Reply-To: To: LF Group Sent: 1/19/2019 3:50:50 PM Subject: Re: LF: EbNaut Hi Jay and all LF EbNauters, Many thanks for your reports and suggestions. And many thanks Jay for your efforts. Yes, indeed: so=20 I'll try tonite with a half of symbol duration, pratically the same pa= rameters used in my transmissions on 14/15 Nov. 2018: QRG: 137545 Hz Coding 8K19A CRC 16 3 sec./sym. 6 characters Duration: 28 min. every 30 minutes, 1st transmission on 2100 UTC, last on 0700 UTC. Reports are welcome as usual... All the best 73 de Riccardo IW4DXW Il giorno Sab 19 Gen 2019, 12:36 jrusgrove@comcast.net ha scritto: Alex, Riccardo & EbNaut-eers Unfortunately no copy of either station last night. Alex ... understan= d your TX frequency may have been moving around. I wonder if a 1 hour transmission is too long for 137 kHz? Recalling s= pectrograms of QRSS going back many years seems to indicate a QSB patt= ern of approximately 15 - 30 minutes. Both receptions of IZ7SLZ and IW= 4DXW (a while back) were 'one=20 and=20 done' with no hint of the signal in adjacent time slots ... using 30 m= inute transmission times. Even DK7FC's=20 normally big signal shows big QSB swings from one half hour period to = the next.=20 Can't help but wonder if 20 or 30 minute transmission periods make bet= ter use of the QSB characteristics on 136 kHz. Comments? Jay W1VD =20 --Yyg=_6OEIoa98e6DJqci1HdameIA5rg1VH Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline
Riccardo
 
Will be interesting to try again once the phase jump problem is r= esolved.
 
Very good results considering antenna and 300 watts!
 
Jay W1VD
 
 
 
 
----- Original Message -----
From: Riccardo Zoli <riccardozoli80@gmail.com>
Sent: 1/20/2019 9:04:07 AM
Subject: Re: LF: EbNaut

Jay and Rob,

thank you again for your effort= s (and patience) to receive my signal across the pond.
Thanks also to Stefan and Miche= l for the plots: I think the undesidered phase jumps problem still not= fully resolved here.

So, good job, Jay! My antenna i= s an inverted "L" (12m. heigh, 36m. long) fed near the top with about = 300W.


All the best

73 de Riccardo IW4DXW
=




Il giorno Dom 20 Gen 2019, 13:50 Rob Renoud <k3= rwr@md.metrocast.net> ha scritto:
Riccardo and Jay,

Great to see you made the TA connection!  No decod= es here unfortunately.

Rob - K3RWR

On Jan 20, 2019, at 06:26, "jrusgr= ove@comcast.net" <jrusgrove@comcast.net> = wrote:

Riccardo
 
Better results last night ... congratulations on 4 decodes! = What is you power and antenna?
 
2200 -
2230 -
2300 -
2330 - 
0000 -
0030 - 
0100 Rank 1 car Eb/N0 1.3 dB Eb/N0 1.1 dB IW4DXW
0130 -
0200 Rank 2067 car Eb/N0 0.7 dB Eb/N0 0.1 dB IW4DX= W
0230 -
0300 -
0330 Rank 0 car Eb/N0 4.6 dB Eb/N0 4.5 dB IW4DXW
0400 -
0430 Rank 284 car Eb/N0 -0.2 dB Eb/N0 -1.2 dB IW4D= XW
0500 -
0530 -
0600 -
0630 -
 
Jay W1VD
 
----- Original Message -----
From: Riccardo Zoli <riccardozoli80= @gmail.com>
Sent: 1/19/2019 3:50:50 PM
Subject: Re: LF: EbNaut

Hi Jay and all LF EbNauters,

Many thanks for your reports and suggestions.
And many thanks Jay for your efforts. Yes, indeed: so I'll try to= nite with a half of symbol duration, pratically the same parameters us= ed in my transmissions on 14/15 Nov. 2018:

QRG: 137545 Hz
Coding 8K19A
CRC 16
3 sec./sym.
6 characters
Duration: 28 min.
every 30 minutes, 1st transmission on 2100 UTC, last on 0700 UTC.=

Reports are welcome as usual...


All the best

73 de Riccardo IW4DXW












Il giorno Sab 19 Gen 2019, 12:36 jrusgrove@comcast.net <jrusgrove@comcast.net> ha scritto:
Alex, Riccardo & EbNaut-eers
 
Unfortunately no copy of either station last night. Alex ...= understand your TX frequency may have been moving around.
 
I wonder if a 1 hour transmission is too long for 137 kHz?&n= bsp;Recalling spectrograms of QRSS going back many years seems to indi= cate a QSB pattern of approximately 15 - 30 minutes. Both receptions o= f IZ7SLZ and IW4DXW (a while back) were 'one and done' with no hi= nt of the signal in adjacent time slots ... using 30 minute transmissi= on times. Even DK7FC's normally big signal shows big QS= B swings from one half hour period to the next. Can't help but wonder = if 20 or 30 minute transmission periods make better use of the QSB cha= racteristics on 136 kHz.
 
Comments?
 
Jay W1VD      
--Yyg=_6OEIoa98e6DJqci1HdameIA5rg1VH--