Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x0JLo74o026579 for ; Sat, 19 Jan 2019 22:50:08 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gkyOr-0007Zi-NK for rs_out_1@blacksheep.org; Sat, 19 Jan 2019 21:43:33 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gkyOX-0007ZX-5F for rsgb_lf_group@blacksheep.org; Sat, 19 Jan 2019 21:43:13 +0000 Received: from resqmta-ch2-09v.sys.comcast.net ([2001:558:fe21:29:69:252:207:41]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1gkyOU-0003on-Pa for rsgb_lf_group@blacksheep.org; Sat, 19 Jan 2019 21:43:11 +0000 Received: from resomta-ch2-11v.sys.comcast.net ([69.252.207.107]) by resqmta-ch2-09v.sys.comcast.net with ESMTP id kyEmgI6Q7sC2NkyOPgPrIB; Sat, 19 Jan 2019 21:43:05 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1547934185; bh=OUnY8bQnHjmorfJzY5VNSfWD2U3jXgoW1FM5tXYui5k=; h=Received:Received:From:Subject:To:Content-Type:MIME-Version:Date: Message-ID; b=P9sVurlgNOq6aZ0Gxy+PGqvQvkodlYiStole/lcfKPBcZi21oX56f9ArCHTfiUr5E /LtGi+oI6/IfxSq3VNpg9a4KDKy83tx4iVeZGMBYV3XWZK4v6VtxKrIEuuBluWSNOa espc6UwwqDX6xwduD0Fk6YUmV3gD9osYkwUtzHiCShoiQJz1iJiF73SREBRzDk1Wde g6o/QN+68f1QpAuQVUWZqTFPg2nM/DFP1D9bLXPpu+9ef+RkqwqFhmQ0QA8R/SsSHj zP8PExYO+Q2JCKOTbE3CErwwER6TmL6y4TtqdM4j0+UFNTgsqZB2+fWR50TVWvbu9R yhQamKcYbe8yQ== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-11v.sys.comcast.net with ESMTPSA id kyOOg52ENaGzLkyOOgsj0F; Sat, 19 Jan 2019 21:43:05 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtledrhedvgdduheefucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuvehomhgtrghsthdqtfgvshhipdfqfgfvpdfpqffurfetoffkrfenuceurghilhhouhhtmecufedttdenucgonfftqdeuohhunhguqdftfedvucdlhedmnecujfgurhephffuvfgtgghffffkjggfsegrtderredtreejnecuhfhrohhmpedfjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdfuceojhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvtheqnecukfhppeejfedrgedrvdehfedrudegudenucfrrghrrghmpehhvghlohepqfhpthhiphhlvgigleektddqrfevpdhinhgvthepjeefrdegrddvheefrddugedupdhmrghilhhfrhhomhepjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdprhgtphhtthhopehrshhgsggplhhfpghgrhhouhhpsegslhgrtghkshhhvggvphdrohhrghenucevlhhushhtvghrufhiiigvpedt X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" MIME-Version: 1.0 References: <1UTCMpy6DA.3Qa4W73pIAl@optiplex980-pc> Date: Sat, 19 Jan 2019 16:43:03 -0500 Message-ID: <1UTCMwovFO.7Td6s5SXdvV@optiplex980-pc> In-Reply-To: User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Riccardo Will be checking for decodes. Bandwidth here +/- 3 Hz centered on 137545 should others care to join in. A winter storm is moving into the area with snow, freezing rain, sleet and the possibility of si [...] Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:41 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: f9f85a03ab18710b130c40acc03380f0 Subject: Re: LF: EbNaut Content-Type: multipart/alternative; boundary="GEyK=_Lm6no3BXgFKhrDiThSbAKhsnYbEh" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: * X-Spam-Status: No, hits=1.9 required=5.0 tests=HTML_30_40,HTML_MESSAGE, MAILTO_TO_SPAM_ADDR,TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format --GEyK=_Lm6no3BXgFKhrDiThSbAKhsnYbEh Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline Riccardo Will be checking for decodes. Bandwidth here +/- 3 Hz centered on 1375= 45 should=20 others care to join in. A winter storm is moving into the area with sn= ow,=20 freezing rain, sleet and the possibility of significant icing. Fingers= crossed=20 that reception is not adversely affected. =20 Jay W1VD=20 ----- Original Message ----- From: Riccardo Zoli Reply-To: To: LF Group Sent: 1/19/2019 3:50:50 PM Subject: Re: LF: EbNaut Hi Jay and all LF EbNauters, Many thanks for your reports and suggestions. And many thanks Jay for your efforts. Yes, indeed: so=20 I'll try tonite with a half of symbol duration, pratically the same pa= rameters used in my transmissions on 14/15 Nov. 2018: QRG: 137545 Hz Coding 8K19A CRC 16 3 sec./sym. 6 characters Duration: 28 min. every 30 minutes, 1st transmission on 2100 UTC, last on 0700 UTC. Reports are welcome as usual... All the best 73 de Riccardo IW4DXW Il giorno Sab 19 Gen 2019, 12:36 jrusgrove@comcast.net ha scritto: Alex, Riccardo & EbNaut-eers Unfortunately no copy of either station last night. Alex ... understan= d your TX frequency may have been moving around. I wonder if a 1 hour transmission is too long for 137 kHz? Recalling s= pectrograms of QRSS going back many years seems to indicate a QSB patt= ern of approximately 15 - 30 minutes. Both receptions of IZ7SLZ and IW= 4DXW (a while back) were 'one=20 and=20 done' with no hint of the signal in adjacent time slots ... using 30 m= inute transmission times. Even DK7FC's=20 normally big signal shows big QSB swings from one half hour period to = the next.=20 Can't help but wonder if 20 or 30 minute transmission periods make bet= ter use of the QSB characteristics on 136 kHz. Comments? Jay W1VD =20 --GEyK=_Lm6no3BXgFKhrDiThSbAKhsnYbEh Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline
Riccardo
 
Will be checking for decodes. Bandwidth here +/- 3 Hz centered on= 137545 should others care to join in. A winter storm is mov= ing into the area with snow, freezing rain, sleet and t= he possibility of significant icing. Fingers crossed that recepti= on is not adversely affected.     
 
Jay W1VD 
 
 
----- Original Message -----
From: Riccardo Zoli <riccardozoli80@gmail.com>
Sent: 1/19/2019 3:50:50 PM
Subject: Re: LF: EbNaut

Hi Jay and all LF EbNauters,

Many thanks for your reports and suggestions.
And many thanks Jay for your efforts. Yes, indeed: so I'll try to= nite with a half of symbol duration, pratically the same parameters us= ed in my transmissions on 14/15 Nov. 2018:

QRG: 137545 Hz
Coding 8K19A
CRC 16
3 sec./sym.
6 characters
Duration: 28 min.
every 30 minutes, 1st transmission on 2100 UTC, last on 0700 UTC.=

Reports are welcome as usual...


All the best

73 de Riccardo IW4DXW












Il giorno Sab 19 Gen 2019, 12:36 jrusg= rove@comcast.net <jrusgrove@comcast.net> = ha scritto:
Alex, Riccardo & EbNaut-eers
 
Unfortunately no copy of either station last night. Alex ...= understand your TX frequency may have been moving around.
 
I wonder if a 1 hour transmission is too long for 137 kHz?&n= bsp;Recalling spectrograms of QRSS going back many years seems to indi= cate a QSB pattern of approximately 15 - 30 minutes. Both receptions o= f IZ7SLZ and IW4DXW (a while back) were 'one and done' with no hi= nt of the signal in adjacent time slots ... using 30 minute transmissi= on times. Even DK7FC's normally big signal shows big QS= B swings from one half hour period to the next. Can't help but wonder = if 20 or 30 minute transmission periods make better use of the QSB cha= racteristics on 136 kHz.
 
Comments?
 
Jay W1VD      
--GEyK=_Lm6no3BXgFKhrDiThSbAKhsnYbEh--