Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x0JBbpLB022860 for ; Sat, 19 Jan 2019 12:37:57 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gkorF-0004Or-PA for rs_out_1@blacksheep.org; Sat, 19 Jan 2019 11:32:13 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gkoqC-0004Oi-S9 for rsgb_lf_group@blacksheep.org; Sat, 19 Jan 2019 11:31:08 +0000 Received: from resqmta-ch2-10v.sys.comcast.net ([2001:558:fe21:29:69:252:207:42]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1gkoq8-0002kw-5j for rsgb_lf_group@blacksheep.org; Sat, 19 Jan 2019 11:31:05 +0000 Received: from resomta-ch2-18v.sys.comcast.net ([69.252.207.114]) by resqmta-ch2-10v.sys.comcast.net with ESMTP id kop4gFLUn1vrfkoq1ghFTW; Sat, 19 Jan 2019 11:30:57 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1547897457; bh=FEVgqd8MyYzaztY2SkM2thnBaSV5rXHNaup22haMVnQ=; h=Received:Received:From:Subject:To:Content-Type:MIME-Version:Date: Message-ID; b=eGTKvqLTRyznXtlWKeTwh3ePJjNTavy5902Rizev26VZS/A9M/hzYca1lk2zJI0kU MSl4MLTKzZnNOzhqRY+dftQgkQfCIdY22CtE0jOZMluFopXvu2KZi7ZGAtSr9V4rN8 TXvbMN78UDZDpmWq6gej40uBe46xKJkWaerPg6dZ3LNHmzjdFFpZcipzoOrnVBby5b /K/tUSMMs+HKSc0lqT6tlAhKfZKGONBeuHcC4a4ZzNQimh7FSUx3RqnjhTsje5s/ek 1HaAYeogGtoG0MybHvLlFnOobvUxKsliF9t6NE3+Va0qLiyZU5r4JiOVdnRUWD2e4t xUlyr02IwN7jQ== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-18v.sys.comcast.net with ESMTPSA id koq0gP1xj3zz9koq1gSJST; Sat, 19 Jan 2019 11:30:57 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtledrhedvgddvkecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddtnecuogfntfdquehouhhnugdqtfefvdculdehmdenucfjughrpefhuffvtgggfhffkfgjfgesrgdtreertderjeenucfhrhhomhepfdhjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtfdcuoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopefqphhtihhplhgvgielkedtqdfrvedpihhnvghtpeejfedrgedrvdehfedrudeguddpmhgrihhlfhhrohhmpehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtpdhrtghpthhtoheprhhsghgspghlfhgpghhrohhuphessghlrggtkhhshhgvvghprdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" MIME-Version: 1.0 References: Date: Sat, 19 Jan 2019 06:30:56 -0500 Message-ID: <1UTCMpy6DA.3Qa4W73pIAl@optiplex980-pc> In-Reply-To: User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Alex, Riccardo & EbNaut-eers Unfortunately no copy of either station last night. Alex ... understand your TX frequency may have been moving around. I wonder if a 1 hour transmission is too long for 137 kHz? Recalling spectrograms of QRSS going back many years seems to indicate a QSB pattern of approximately 15 - 30 minutes. Both receptions of IZ7 [...] Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:42 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: 9d01e9df836df8dd3868645661e1c1f7 Subject: LF: EbNaut Content-Type: multipart/alternative; boundary="yMTO9mi7oJQU42wg=_8pmnRSMvy9WCgiag" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: X-Spam-Status: No, hits=0.5 required=5.0 tests=HTML_20_30,HTML_MESSAGE, TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format --yMTO9mi7oJQU42wg=_8pmnRSMvy9WCgiag Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline Alex, Riccardo & EbNaut-eers Unfortunately no copy of either station last night. Alex ... understan= d your TX=20 frequency may have been moving around. I wonder if a 1 hour transmission is too long for 137 kHz? Recalling=20= spectrograms of QRSS going back many years seems to indicate a QSB pat= tern of=20 approximately 15 - 30 minutes. Both receptions of IZ7SLZ and IW4DXW (a= while=20 back) were 'one and done' with no hint of the signal in adjacent time = slots ...=20 using 30 minute transmission times. Even=20 DK7FC's normally big signal shows big QSB swings from one half hour pe= riod to the next. Can't=20 help but wonder if 20 or 30 minute transmission periods make better us= e of the=20 QSB characteristics on 136 kHz. Comments? Jay W1VD =20 --yMTO9mi7oJQU42wg=_8pmnRSMvy9WCgiag Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline
Alex, Riccardo & EbNaut-eers
 
Unfortunately no copy of either station last night. Alex ...= understand your TX frequency may have been moving around.
 
I wonder if a 1 hour transmission is too long for 137 kHz?&n= bsp;Recalling spectrograms of QRSS going back many years seems to indi= cate a QSB pattern of approximately 15 - 30 minutes. Both receptions o= f IZ7SLZ and IW4DXW (a while back) were 'one and done' with no hi= nt of the signal in adjacent time slots ... using 30 minute transmissi= on times. Even DK7FC's normally big signal shows big QS= B swings from one half hour period to the next. Can't help but wonder = if 20 or 30 minute transmission periods make better use of the QSB cha= racteristics on 136 kHz.
 
Comments?
 
Jay W1VD      
--yMTO9mi7oJQU42wg=_8pmnRSMvy9WCgiag--