Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x0IK1O8q018436 for ; Fri, 18 Jan 2019 21:01:25 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gkaFq-0001aO-MT for rs_out_1@blacksheep.org; Fri, 18 Jan 2019 19:56:38 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gkaFq-0001aF-B6 for rsgb_lf_group@blacksheep.org; Fri, 18 Jan 2019 19:56:38 +0000 Received: from resqmta-ch2-01v.sys.comcast.net ([2001:558:fe21:29:69:252:207:33]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1gkaFo-0001CI-8m for rsgb_lf_group@blacksheep.org; Fri, 18 Jan 2019 19:56:37 +0000 Received: from resomta-ch2-17v.sys.comcast.net ([69.252.207.113]) by resqmta-ch2-01v.sys.comcast.net with ESMTP id ka5UggrOJaPJWkaFhgXmL5; Fri, 18 Jan 2019 19:56:30 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1547841390; bh=Yta3YD91Hf5uoPwewbdxMCIuPB1Z7cOW3b7amSsL+rc=; h=Received:Received:From:Subject:To:Content-Type:MIME-Version:Date: Message-ID; b=ExFya5EgbYXfPsQtF9pFFTB/84BbYIc7HatrWE5WDk/TZf0Xj8G2m9ae9PxzF0yhh aw2X3AuHh5jnnFBufHRcGE9HaIXEsB8YEb6L1XovSMheMkeamAajnmVoZqcxEwaPwM ahVTNj8BpUBubIXNFYPx+pEijBdCad8IdshpiaLObKDv6dsn1Sxsbe4xDOdzCnei3A GWPnns4OIzRgALvlNzmjblnuwTQyamS7oImItrg5j0cdNUevwba8D0oemrcmXdU3tL +Tu/8NDHa1i2JG7wTQNpRQFVRZqV0T35uJceIdo+F0FqvszdJ/5/7S7YrXWJ1PW2Wo ranDm5SdSS+5g== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-17v.sys.comcast.net with ESMTPSA id kaFggDcQEDNxVkaFhglsGz; Fri, 18 Jan 2019 19:56:29 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtledrhedtgddufeefucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuvehomhgtrghsthdqtfgvshhipdfqfgfvpdfpqffurfetoffkrfenuceurghilhhouhhtmecufedttdenucgonfftqdeuohhunhguqdftfedvucdlhedmnecujfgurhephffuvfgtgghffffkjggfsegrtderredtreejnecuhfhrohhmpedfjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdfuceojhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvtheqnecukfhppeejfedrgedrvdehfedrudegudenucfrrghrrghmpehhvghlohepqfhpthhiphhlvgigleektddqrfevpdhinhgvthepjeefrdegrddvheefrddugedupdhmrghilhhfrhhomhepjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdprhgtphhtthhopehrshhgsggplhhfpghgrhhouhhpsegslhgrtghkshhhvggvphdrohhrghenucevlhhushhtvghrufhiiigvpedt X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" MIME-Version: 1.0 References: <1541712573053.31739@kuleuven.be> <5C3CFB7E.2010605@posteo.de> <5C3CFC32.9030509@posteo.de> <5C3E51A1.9020702@posteo.de> <5C3F2E54.1080204@posteo.de> <5C403B5E.90401@posteo.de> <1UTCLkF3Qy.aG0RgEBqcpT@optiplex980-pc> <5C42156D.1000601@posteo.de> Date: Fri, 18 Jan 2019 14:56:28 -0500 Message-ID: <1UTCLpsfCn.ngRI5xHJlZz@optiplex980-pc> In-Reply-To: User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Riccardo Will be monitoring your 56 minute transmissions tonight. Looking +/- 3 Hz of 137545 in case others would like to join in. Jay W1VD Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:33 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: 4ad75ad27eb9a353f40105f6e3872b5c Subject: Re: LF: Re: EbNaut tonite Content-Type: multipart/alternative; boundary="YAtwZBHd7TCG3bqF3c=_Z6NikS5cXI7sBc" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: * X-Spam-Status: No, hits=1.5 required=5.0 tests=HTML_40_50,HTML_MESSAGE, MAILTO_TO_SPAM_ADDR,TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format --YAtwZBHd7TCG3bqF3c=_Z6NikS5cXI7sBc Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline Riccardo Will be monitoring your 56 minute transmissions tonight. Looking +/- 3= Hz of=20 137545 in case others would like to join in. Jay W1VD=20 ----- Original Message ----- From: Riccardo Zoli Reply-To: To: LF Group Sent: 1/18/2019 1:48:37 PM Subject: Re: LF: Re: EbNaut tonite Hi LF. Congratulations to Stefan, Domenico and Jay for great results. Yes, Stefan. Tonite, I'll try again (and again :-)) with 300 W...my do= ubt, last nights, was the phase stability which I hope I have now reso= lved. So: QRG: 137545 Hz Coding 8K19A CRC 16 6 sec./sym. 6 characters Duration: 56 min. (hourly, 1st on 2000 UTC, last on 0700 UTC) Reports are welcome. All the best 73 de Riccardo IW4DXW Il 18 Gen 2019 7:14 PM, "DK7FC" ha scritto: Hi Jay,=20 Great results, many thanks. The phase is unepected stable. And then th= e surprise in the last transmission with no symbol error over the 6099= km path! I was running about 180 W only. We could try a 1 hour long message some time, or maybe Riccardo or Dom= enico wants to try.=20 Now i give you a break since you had a lot of work with me in the last= days ;-) Tnx, 73, Stefan Am 18.01.2019 12:23, schrieb jrusgrove@comcast.net:=20 Stefan Final decode was a surprise! 2200 setup not running yet 2300 Rank 0 car Eb/N0 12.5 dB Eb/N0 11.8 dB 73LF 0000 Rank 0 car Eb/N0 16.4 dB Eb/N0 15.5 dB 73LF 0100 Rank 0 car Eb/N0 14.1 dB Eb/N0 11.4 dB 73LF 0200 Rank 0 car Eb/N0 7.0 dB Eb/N0 6.2 dB 73LF 0300 Rank 0 car Eb/N0 12.2 dB Eb/N0 12.1 dB 73LF 0400 Rank 0 car Eb/N0 10.6 dB Eb/N0 8.0 dB 73LF 0500 Rank 0 car Eb/N0 10.0 dB Eb/N0 8.8 dB 73LF 0600 Rank 0 car Eb/N0 18.1 dB Eb/N0 70.1 dB 73LF Jay W1VD --YAtwZBHd7TCG3bqF3c=_Z6NikS5cXI7sBc Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline
Riccardo
 
Will be monitoring your 56 minute transmissions tonight. Looking = +/- 3 Hz of 137545 in case others would like to join in.
 
Jay W1VD 
 
 
----- Original Message -----
From: Riccardo Zoli <riccardozoli80@gmail.com>
Sent: 1/18/2019 1:48:37 PM
Subject: Re: LF: Re: EbNaut tonite

Hi LF.

Congratulations to Stefan, Domenico and Jay for great results.

Yes, Stefan. Tonite, I'll try again (and again :-)) with 300 W...= my doubt, last nights, was the phase stability which I hope I have now= resolved. So:

QRG: 137545 Hz
Coding 8K19A
CRC 16
6 sec./sym.
6 characters
Duration: 56 min.

(hourly, 1st on 2000 UTC, last on 0700 UTC)

Reports are welcome.

All the best


73 de Riccardo IW4DXW




Il 18 Gen 2019 7:14 PM, "DK7FC" <selberdenken@posteo.de> ha scritto:
Hi Jay,

Great result= s, many thanks. The phase is unepected stable. And then the surprise i= n the last transmission with no symbol error over the 6099 km path! I = was running about 180 W only.
We could try a 1 hour long message so= me time, or maybe Riccardo or Domenico wants to try.
Now i give yo= u a break since you had a lot of work with me in the last days ;-)
=
Tnx, 73, Stefan



Am 18.01.2019 12:23, schrieb jrusgrove@comcast.net:=20
Stefan
 
Final decode was a surprise!
 
 
2200 setup not running yet
 
2300 Rank 0 car Eb/N0 12.5 dB Eb/N0 11.8 dB 73LF
 
3D""
 
0000 Rank 0 car Eb/N0 16.4 dB Eb/N0 15.5 dB 73LF
 
3D""
 
0100 Rank 0 car Eb/N0 14.1 dB Eb/N0 11.4 dB 73LF
 
3D""
 
0200 Rank 0 car Eb/N0 7.0 dB Eb/N0 6.2 dB 73LF
 
3D""
 
0300 Rank 0 car Eb/N0 12.2 dB Eb/N0 12.1 dB 73LF
 
3D""
 
0400 Rank 0 car Eb/N0 10.6 dB Eb/N0 8.0 dB 73LF
 
3D""
 
0500 Rank 0 car Eb/N0 10.0 dB Eb/N0 8.8 dB 73LF
 
3D""
 
0600 Rank 0 car Eb/N0 18.1 dB Eb/N0 70.1 dB 73LF
 
3D""
 
Jay W1VD
 
 
 
 
--YAtwZBHd7TCG3bqF3c=_Z6NikS5cXI7sBc--