Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x0IBVMDF016135 for ; Fri, 18 Jan 2019 12:31:23 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gkSJ0-0000VH-Pq for rs_out_1@blacksheep.org; Fri, 18 Jan 2019 11:27:22 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gkSIz-0000Uq-N4 for rsgb_lf_group@blacksheep.org; Fri, 18 Jan 2019 11:27:21 +0000 Received: from resqmta-ch2-01v.sys.comcast.net ([2001:558:fe21:29:69:252:207:33]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1gkSIx-0000Gm-Oi for rsgb_lf_group@blacksheep.org; Fri, 18 Jan 2019 11:27:20 +0000 Received: from resomta-ch2-12v.sys.comcast.net ([69.252.207.108]) by resqmta-ch2-01v.sys.comcast.net with ESMTP id kSAeggIWOaPJWkSItgWPua; Fri, 18 Jan 2019 11:27:15 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1547810835; bh=1qDng8sA9Iwnwt36rBoD4+eGw3hh22YNTyLQUa/LbGk=; h=Received:Received:From:Subject:To:Content-Type:MIME-Version:Date: Message-ID; b=kp1pOWifF8uyuSeY+M2c9ARxEMZPXoNTCnX1T300LefKV0LbGw5BGkiAM0M5oDzZT dMfIZ5aTwQljRaHTap8YwYnAJF+QQy099X7AZzhxl8ZjTx+IgIgmSmmTK35dyZYZGe fPKyh9Orw2svgC6HhVneRm8MkNwJpDHAjxaqrZOP5d9DKumAdMs+kvMoY0t9k/0rC6 /413/PCXhd9TYZw2kf1aJ9V+JmpQp1AdzP6FkcVDUExC0kxli+2TRz1pwvA7LOCx4i fczA18vyl/8v4pypsagUA4rIE7kN08y4yxFtkcHOCBR1QQGw2SNii4/YOZX2HJocMw CyanHlOeFEnDw== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-12v.sys.comcast.net with ESMTPSA id kSIsgcwcmKHFDkSIsgKKyF; Fri, 18 Jan 2019 11:27:15 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtledrhedtgdeftdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddtnecuogfntfdquehouhhnugdqtfefvdculdehmdenucfjughrpefhuffvtgggfhffkfgjfgesrgdtreertderjeenucfhrhhomhepfdhjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtfdcuoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucffohhmrghinhepjeefrdhruhenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopefqphhtihhplhgvgielkedtqdfrvedpihhnvghtpeejfedrgedrvdehfedrudeguddpmhgrihhlfhhrohhmpehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtpdhrtghpthhtoheprhhsghgspghlfhgpghhrohhuphessghlrggtkhhshhgvvghprdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" MIME-Version: 1.0 References: <579760091.881712.1547682757936.ref@mail.yahoo.com> <579760091.881712.1547682757936@mail.yahoo.com> <1UTCKnNYR8.YaMMd4rvIM9@optiplex980-pc> Date: Fri, 18 Jan 2019 06:27:13 -0500 Message-ID: <1UTCLkGlMq.jVcJmPTVwPR@optiplex980-pc> In-Reply-To: User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Alex Yes ... congrats to Domenico on first T/A reception! Thanks for all your hard work keeping the list up to date. Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:33 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: 86a33fe05fd4c52b025518dbd249b8c0 Subject: Re: LF: Re: EbNaut tonite Content-Type: multipart/alternative; boundary="cBpHLO=_h8nalTOhPFT9oxEMJM6iA9Lh5S" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: X-Spam-Status: No, hits=0.4 required=5.0 tests=HTML_50_60,HTML_FONTCOLOR_BLUE, HTML_FONTCOLOR_UNSAFE,HTML_MESSAGE,TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format --cBpHLO=_h8nalTOhPFT9oxEMJM6iA9Lh5S Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline Alex Yes ... congrats to Domenico on first T/A reception! =20 Thanks for all your hard work keeping the list up to date. Jay W1VD =20 ----- Original Message ----- From: Alex R7NT Reply-To: To: Sent: 1/18/2019 12:46:45 AM Subject: Re: LF: Re: EbNaut tonite Jay and Dom, This was First RX of Domenico TX in NA (QRB over 7150km) ! CONGRATS to both!=20 EbNaut is beautifull digital mode! =20 IZ7SLZ > AWLF 1 Hall of Fame #55 73! Alex R7NT 136.73.ru AWLF 136.73.ru/h_aw =D0=BF=D1=82, 18 =D1=8F=D0=BD=D0=B2. 2019 =D0=B3. =D0=B2 03:32, jrusgr= ove@comcast.net : Domenico, Riccardo Checking last night's files I found one decode from your station ... s= ee below. Unfortunately there were no decodes from Riccardo. 0000 Rank 0 car Eb/N0 5.2 dB Eb/N0 4.2 dB JN80 Jay W1VD ----- Original Message ----- From: Domenico IZ7SLZ Reply-To: To: Sent: 1/16/2019 7:18:10 PM Subject: Re: LF: Re: EbNaut tonite Yes Markus,=20 QRG has been corrected at 137546.5 Hz. Thanks for the advice. Again on air now ! 73, Dom. --cBpHLO=_h8nalTOhPFT9oxEMJM6iA9Lh5S Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline
Alex
 
Yes ... congrats to Domenico on first T/A reception! 
=
 
Thanks for all your hard work keeping the list up to date.
 
Jay W1VD  
 
 
----- Original Message -----
From: Alex R7NT <r= 7nt.73@gmail.com>
Sent: 1/18/2019 12:46:45 AM
Subject: Re: LF: Re: EbNaut tonite
Jay and Dom,
This was First RX of Domenico TX in NA (QRB over 7150km= ) !
CONGRATS to both! 
EbNaut is beautifull digital mode!  
IZ7SLZ > AWLF 1 Hall of Fame #55

73! Alex R7NT  136.73.ru    AWLF 136.73.ru/h_aw


=D0=BF=D1=82, 18 =D1=8F=D0=BD=D0=B2.= 2019 =D0=B3. =D0=B2 03:32, j= rusgrove@comcast.net <= jrusgrove@comcast.net>:
Domenico, Riccardo
 
Checking last night's files I found one decode from your station = =2E.. see below. Unfortunately there were no decodes from Riccardo.
 
0000 Rank 0 car Eb/N0 5.2 dB Eb/N0 4.2 dB JN80
 
 
Jay W1VD
 
 
 
----- Original Message -----
From: Domenico IZ7SLZ <iz7slz.domenico@gmail.com>
Sent: 1/16/2019 7:18:10 PM
Subject: Re: LF: Re: EbNaut tonite
Yes Markus,=20
QRG has been corrected at 137546.5 Hz.
Thanks for the advice.

Again on air now !
73, Dom.
--cBpHLO=_h8nalTOhPFT9oxEMJM6iA9Lh5S--