Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x0I0Z0K6012883 for ; Fri, 18 Jan 2019 01:35:11 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gkHys-0007yo-Po for rs_out_1@blacksheep.org; Fri, 18 Jan 2019 00:25:54 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gkHyg-0007yc-8r for rsgb_lf_group@blacksheep.org; Fri, 18 Jan 2019 00:25:42 +0000 Received: from resqmta-ch2-02v.sys.comcast.net ([2001:558:fe21:29:69:252:207:34]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1gkHyd-0007VD-EN for rsgb_lf_group@blacksheep.org; Fri, 18 Jan 2019 00:25:41 +0000 Received: from resomta-ch2-15v.sys.comcast.net ([69.252.207.111]) by resqmta-ch2-02v.sys.comcast.net with ESMTP id kB6OgQkhM9VLokHyVg66Qp; Fri, 18 Jan 2019 00:25:31 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1547771131; bh=z/izIqT2iPRThFNrP1DVDbzFV9JJ0qZdvC+I6LRa3ww=; h=Received:Received:From:Subject:To:Content-Type:MIME-Version:Date: Message-ID; b=X7LM16W4dSstX8SlbEsCTBHhdE2W7HoRSuW6ne+8M4ojR+Fod5iaZI9Hit5/rgaK4 L8ydQ1/6CZ3BH0sRx50VeBjF1XlTdUNKbK9KIrhrIqkhmFC8D8FthLFm9OCkpaYbgU Pn/Jpf0A62NOnn6oKJkAf1dlZ6pNAIxMtGOO2Ap6wfuXrW9bwPLDIqEBD9m/kpEkGB 5+3FIkcZ7ATMtY7+bUbss1/GrL8BMN35nmB7oMIlgDOxuY/7TQI15BowH+FcGWSnRL yLSizQtnpHAs6yd9R3O5bjIt2AXfxIOtFpHRfptP7KelfcQ26NQqEI6EYtfl3mzfYo 3eoDhjU5BHXng== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-15v.sys.comcast.net with ESMTPSA id kHySgPQ8tmAmFkHyTgBz7I; Fri, 18 Jan 2019 00:25:31 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtledrgeelgddvtdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddtnecuogfntfdquehouhhnugdqtfefvdculdehmdenucfjughrpefhuffvtgggfhffkfgjfgesrgdtreertderjeenucfhrhhomhepfdhjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtfdcuoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopefqphhtihhplhgvgielkedtqdfrvedpihhnvghtpeejfedrgedrvdehfedrudeguddpmhgrihhlfhhrohhmpehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtpdhrtghpthhtoheprhhsghgspghlfhgpghhrohhuphessghlrggtkhhshhgvvghprdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" MIME-Version: 1.0 References: <579760091.881712.1547682757936.ref@mail.yahoo.com> <579760091.881712.1547682757936@mail.yahoo.com> Date: Thu, 17 Jan 2019 19:25:28 -0500 Message-ID: <1UTCKnNYR8.YaMMd4rvIM9@optiplex980-pc> In-Reply-To: User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Domenico, Riccardo Checking last night's files I found one decode from your station ... see below. Unfortunately there were no decodes from Riccardo. 0000 Rank 0 car Eb/N0 5.2 dB Eb/N0 4.2 dB JN80 Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:34 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: bf9cd6b3d49c805062abf73a1027fea8 Subject: Re: LF: Re: EbNaut tonite Content-Type: multipart/alternative; boundary="Hk8fBS8NS6mRYrl23M33og=_pLVHxYfnxT" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: X-Spam-Status: No, hits=0.5 required=5.0 tests=HTML_40_50,HTML_MESSAGE, TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format --Hk8fBS8NS6mRYrl23M33og=_pLVHxYfnxT Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline Domenico, Riccardo Checking last night's files I found one decode from your station ... s= ee below. Unfortunately there were no decodes from Riccardo. 0000 Rank 0 car Eb/N0 5.2 dB Eb/N0 4.2 dB JN80 Jay W1VD ----- Original Message ----- From: Domenico IZ7SLZ Reply-To: To: Sent: 1/16/2019 7:18:10 PM Subject: Re: LF: Re: EbNaut tonite Yes Markus, QRG has been corrected at 137546.5 Hz. Thanks for the advice. Again on air now ! 73, Dom. --Hk8fBS8NS6mRYrl23M33og=_pLVHxYfnxT Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline
Domenico, Riccardo
 
Checking last night's files I found one decode from your station = =2E.. see below. Unfortunately there were no decodes from Riccardo.
 
0000 Rank 0 car Eb/N0 5.2 dB Eb/N0 4.2 dB JN80
 
 
Jay W1VD
 
 
 
----- Original Message -----
From: Domenico IZ7SLZ <iz7slz.domenico@gmail.com>
Sent: 1/16/2019 7:18:10 PM
Subject: Re: LF: Re: EbNaut tonite
Yes Markus,
QRG has been corrected at 137546.5 Hz.
Thanks for the advice.

Again on air now !
73, Dom.
--Hk8fBS8NS6mRYrl23M33og=_pLVHxYfnxT--