Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x0GEfsrY003213 for ; Wed, 16 Jan 2019 15:41:55 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gjmIO-0001RQ-53 for rs_out_1@blacksheep.org; Wed, 16 Jan 2019 14:35:56 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gjmI2-0001RH-Rg for rsgb_lf_group@blacksheep.org; Wed, 16 Jan 2019 14:35:34 +0000 Received: from resqmta-ch2-06v.sys.comcast.net ([2001:558:fe21:29:69:252:207:38]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1gjmI0-0003ds-FX for rsgb_lf_group@blacksheep.org; Wed, 16 Jan 2019 14:35:33 +0000 Received: from resomta-ch2-07v.sys.comcast.net ([69.252.207.103]) by resqmta-ch2-06v.sys.comcast.net with ESMTP id jkEfgwbaNbX9CjmHvgbYE6; Wed, 16 Jan 2019 14:35:27 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1547649327; bh=q7YxxEV0louxJP84KeZWBsuOc3u3R1AfpQUiILLNsv4=; h=Received:Received:From:Subject:To:Content-Type:MIME-Version:Date: Message-ID; b=myH+UMUSIlyzdIXveu8B6X2H+TlKb7jPNJFXJo2Y4sOMspa3b60MrUvU+vtEpf2UR gZr+IfK6XPI1TrJSr1ieLxp+p0KECJcXwGuZtb3LYETGI8XKOqk93AvhQT0G7EBP2Z pJr3AtkN76v9wO88Oj7eg7CXZYdem9F25eToNeTnX3HbbcerUOGgDvMClqQ7psbHnf 8UaG/aTuzTb6s0om9MrpsbgoGZCvqKKlBpcfx4Kws6QENHoqjdys0t025Cw62TjoqP FPFKafLWNSMF13NMmEyo6Jr3MS/Is6zIXIdjF7fJXuwzNub2VI8QBUwqiIPmCyx0uk k9MNNbhwH+HeQ== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-07v.sys.comcast.net with ESMTPSA id jmHugBGfIWNLAjmHuggUYG; Wed, 16 Jan 2019 14:35:27 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtledrgeehgdeijecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfenuceurghilhhouhhtmecufedttdenucgonfftqdeuohhunhguqdftfedvucdlhedmnecujfgurhephffuvfgtgghffffkjggfsegrtderredtreejnecuhfhrohhmpedfjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdfuceojhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvtheqnecukfhppeejfedrgedrvdehfedrudegudenucfrrghrrghmpehhvghlohepqfhpthhiphhlvgigleektddqrfevpdhinhgvthepjeefrdegrddvheefrddugedupdhmrghilhhfrhhomhepjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdprhgtphhtthhopehrshhgsggplhhfpghgrhhouhhpsegslhgrtghkshhhvggvphdrohhrghenucevlhhushhtvghrufhiiigvpedt X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" MIME-Version: 1.0 References: <1541712573053.31739@kuleuven.be> <1577921AD94DD17B.1915@groups.io> <1547497870081.57956@kuleuven.be> <5C3CFB7E.2010605@posteo.de> <5C3CFC32.9030509@posteo.de> <5C3E51A1.9020702@posteo.de> <5C3F2E54.1080204@posteo.de> Date: Wed, 16 Jan 2019 09:35:25 -0500 Message-ID: <1UTCJb0Fdh.G96iOwarM1A@optiplex980-pc> In-Reply-To: <5C3F2E54.1080204@posteo.de> User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Stefan Wasn't home in time to set things up so missed the 2200 transmission ... I'm reasonably sure it would have produced a decode. With sufficient advanced notice, as provided today, the setup will be runn [...] Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:38 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: 280b6f92979e78e2e1f858016e075ea9 Subject: Re: LF: Re: EbNaut tonite Content-Type: multipart/alternative; boundary="QvG3hfyhcNXTgxXRFm=_IOxYfMwXQW6E0I" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: X-Spam-Status: No, hits=0.2 required=5.0 tests=HTML_70_80,HTML_MESSAGE, HTML_TAG_EXISTS_TBODY,TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format --QvG3hfyhcNXTgxXRFm=_IOxYfMwXQW6E0I Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline Stefan Wasn't home in time to set things up so missed the 2200 transmission .= =2E. I'm=20 reasonably sure it would have produced a decode. With sufficient advan= ced=20 notice, as provided today, the setup will be running in time for the e= arly=20 transmission. Thanks for the LF Eb/N0 signal! Jay W1VD=20 ----- Original Message ----- From: DK7FC Reply-To: To: Sent: 1/16/2019 8:15:00 AM Subject: Re: LF: Re: EbNaut tonite Hello Rob and Jay,=20 Many thanks for the reports and all the details. Jay, did you miss the= 22 UTC=20 transmission or did it not decode? Interesting to see the phase plots. It is expected that the phase is l= ess=20 stable when the band opens. In the last transmission, the Eb/N0 is not= high=20 enough to see the phase pattern. I wonder if the traces become more evident if 4K19 is used. What happens when a solar event happens during the transmission time? = Does it=20 change the phase or just the D layer attenuation? Maybe we can repeat the experiment, using 4K19A. Of course a carrier c= ould be=20 used too, but i like to 'play' with EbNaut. So, tonite: f =3D 137.545 kHz Start time: 16.JAN.2019 22:00:00.3 UTC Symbol period: 8 s Characters: 4 CRC bits: 16 Coding 4K19A Antenna current: 4 A Duration: 30:56 [mm:ss] 73, Stefan Am 16.01.2019 12:29, schrieb Rob Renoud:=20 Stefan, Late start but 7 successful decodes. Have not gotten to phase plots y= et... UTCRankC Eb/N0Eb/N0MSGRef Phase 010005.61.620190,-30,0 30 020006.90.4201960,30 30 0 030009.95.8201990,60,60,0 0400011.28.82019180,180,150,150 050006.32.720190,-30,-30,-60 73, Rob =E2=80=93 K3RWR From: DK7FC=20 Sent: Tuesday, January 15, 2019 9:33 PM To: rsgb_lf_group@blacksheep.org=20 Subject: Re: LF: Re: EbNaut tonite LF,=20 Today, the messages will be transmitted as announced, starting 22 UTC 73, Stefan Am 14.01.2019 22:16, schrieb DK7FC:=20 PS: Repeatinh hourly, until including 6 UTC. Am 14.01.2019 22:13, schrieb DK7FC:=20 Hi LF,=20 Just a short EbNaut message tonite.=20 I'm interested to see the phase changes on a long path. Markus's showr= awsyms=20 does a good job there, as long as 8K19A is used. A shorter message sho= uld also=20 help to build up a clear trace. So let's try an unusual short message: f =3D 137.545 kHz Start time: 14.JAN.2019 22:00:00.3 UTC Symbol period: 4 s Characters: 4 CRC bits: 16 Coding 8K19A Antenna current: 4 A Duration: 30:56 [mm:ss] Reports, including phase plots, welcome :-) 73, Stefan --QvG3hfyhcNXTgxXRFm=_IOxYfMwXQW6E0I Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline
Stefan
 
Wasn't home in time to set things up so missed the 2200 tran= smission ... I'm reasonably sure it would have produced a decode. With= sufficient advanced notice, as provided today, the setup will be runn= ing in time for the early transmission.
 
Thanks for the LF Eb/N0 signal!
 
Jay W1VD 
 
 
----- Original Message -----
Sent: 1/16/2019 8:15:00 AM
Subject: Re: LF: Re: EbNaut tonite
Hello Rob and Jay,

Many thanks for the reports and all the det= ails. Jay, did you miss the 22 UTC transmission or did it not decode?<= BR>Interesting to see the phase plots. It is expected that the phase i= s less stable when the band opens. In the last transmission, the Eb/N0= is not high enough to see the phase pattern.
I wonder if the trace= s become more evident if 4K19 is used.

What happens when a sola= r event happens during the transmission time? Does it change the phase= or just the D layer attenuation?
Maybe we can repeat the experimen= t, using 4K19A. Of course a carrier could be used too, but i like to '= play' with EbNaut.

So, tonite:

f =3D 137.545 kHz
S= tart time: 16.JAN.2019  22:00:00.3 UTC
Symbol period: 8 s
C= haracters: 4
CRC bits: 16
Coding 4K19A
Antenna cur= rent: 4 A
Duration: 30:56 [mm:ss]


 73, Stefan

Am 16.01.2019 12:29, schrieb Rob Renoud:=20
Stefan,
 
Late start but 7 successful decodes.  Have not gotten to pha= se plots yet...
 
UTC Rank C Eb/N0 Eb/N0 MSG Ref Phase
0100 0 5.6 1.6 2019 0,-30,0 30
0200 0 6.9 0.4 2019 60,30 30 0
0300 0 9.9 5.8 2019 90,60,60,0
0400 0 11.2 8.8 2019 180,180,150,150
0500 0 6.3 2.7 2019 0,-30,-30,-60=
 
73,
Rob =E2=80=93 K3RWR
 
 
From: DK7FC
Sent: Tuesday, January 15, 2019 9:33 PM
Subject: Re: LF: Re: EbNaut tonite
 
LF,

Today, the messages will be transmitted as= announced, starting 22 UTC

73, Stefan

Am 14.01.2019 22:= 16, schrieb DK7FC:=20
PS: Re= peatinh hourly, until including 6 UTC.

Am 14.01.2019 22:13, sch= rieb DK7FC:=20
Hi LF,=

Just a short EbNaut message tonite. I'm interested to see the= phase changes on a long path. Markus's showrawsyms does a good job th= ere, as long as 8K19A is used. A shorter message should also help to b= uild up a clear trace.
So let's try an unusual short message:
f =3D 137.545 kHz
Start time: 14.JAN.2019  22:00:00.3 UTC=
Symbol period: 4 s
Characters: 4
CRC bits: 16
= Coding 8K19A
Antenna current: 4 A
Duration: 30:56 [mm:ss]
Reports, including phase plots, welcome :-)

73, Stefan
=
= --QvG3hfyhcNXTgxXRFm=_IOxYfMwXQW6E0I--