Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x0DBU6xt015070 for ; Sun, 13 Jan 2019 12:30:18 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1giduD-0006qi-4O for rs_out_1@blacksheep.org; Sun, 13 Jan 2019 11:26:17 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gidtu-0006qZ-IV for rsgb_lf_group@blacksheep.org; Sun, 13 Jan 2019 11:25:58 +0000 Received: from resqmta-ch2-05v.sys.comcast.net ([2001:558:fe21:29:69:252:207:37]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.89) (envelope-from ) id 1gidtr-0003XR-9w for rsgb_lf_group@blacksheep.org; Sun, 13 Jan 2019 11:25:56 +0000 Received: from resomta-ch2-01v.sys.comcast.net ([69.252.207.97]) by resqmta-ch2-05v.sys.comcast.net with ESMTP id idqMgGOiYeuuRidtmgzwLU; Sun, 13 Jan 2019 11:25:50 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1547378750; bh=2Uk9NlFmWepmMo1uRBQ9dPObafI7dGwcryPiGgFpE2U=; h=Received:Received:From:Subject:To:Content-Type:Date:Message-ID; b=P1vCTdNvnUemmJPz7Yw8akBPzKP+2gFYjrPWFzFY1Ui6V/07Xnxwnsxa5wshIVhnh 3DgUGYJCUV2h5sl0lJv/K8fTnojhlMHnI2tH6N5Fjz2ez6B2MrtOmW/6G/GbX3nIAG CsgVt+z9DwmFhZzYP8KcHU6aEFg0DcfiSo8nBYwqLmpca81e00hFRTE1x7U4p92Z2Z uSJ7dFXbCLqdx81Q/94O4zvQkbGIbH4lw0fXCLo+SWK2mWzaIQa39ljLaQG6K9dcvh uKl1AoFCv5rvsejXcq3Sgcp7/+sxhtTwYbWxRh+898v9OOB1VI4J2NXfavxHO89Bos 6tm4zTSWoqYIw== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-01v.sys.comcast.net with ESMTPSA id idtlg4F8029QvidtlgTEj5; Sun, 13 Jan 2019 11:25:50 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtledrfeelgdeftdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfenuceurghilhhouhhtmecufedttdenucenucfjughrpefhuffvtgfgfhffkfgjfgesthhqredttderjeenucfhrhhomhepfdhjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtfdcuoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopefqphhtihhplhgvgielkedtqdfrvedpihhnvghtpeejfedrgedrvdehfedrudeguddpmhgrihhlfhhrohhmpehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtpdhrtghpthhtoheprhhsghgspghlfhgpghhrohhuphessghlrggtkhhshhgvvghprdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" References: <1541712573053.31739@kuleuven.be> <5C3A26FF.4020205@posteo.de> <965011547315543@iva6-19b25c513db4.qloud-c.yandex.net> <50F4E99D3515424491D13D3DF198AF7A@DESKTOPG5Q6IA2> <5C3A442E.80903@posteo.de> <771E0F60DAA2422FA7DCB0B0497803E4@DESKTOPG5Q6IA2> <5C3A5324.4040807@posteo.de> <5C3A57ED.40903@posteo.de> <5C3B123C.3080502@posteo.de> Date: Sun, 13 Jan 2019 06:25:48 -0500 Message-ID: <1UTCGHsa2H.2Y7aF1yGX9q@optiplex980-pc> In-Reply-To: <5C3B123C.3080502@posteo.de> User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Stefan >Thanks for the decodes. Also W1VD did a great job last night. Not all of the spots were uploaded last night ... just cleaned out ALL_WSPR.TXT file which should help. Complete list below. Turned receiver on around 0020 so looks like a clean sweep from that point [...] Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:37 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: 4e3b1488273adbbe9757d6bdd5adf219 Subject: Re: LF: LF tonite Content-Type: text/plain; charset=utf-8 X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: X-Spam-Status: No, hits=0.0 required=5.0 tests=TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false Content-Transfer-Encoding: 8bit X-MIME-Autoconverted: from quoted-printable to 8bit by klubnl.pl id x0DBU6xt015070 Stefan >Thanks for the decodes. Also W1VD did a great job last night. Not all of the spots were uploaded last night ... just cleaned out ALL_WSPR.TXT file which should help. Complete list below. Turned receiver on around 0020 so looks like a clean sweep from that point forward ... at least until 0430. WSPR15 performance is quite remarkable! 2019-01-13 04:30 DK7FC 0.137620 -35 0 JN49ik 1 W1VD FN31ls 6099 295 2019-01-13 04:00 DK7FC 0.137620 -31 0 JN49ik 1 W1VD FN31ls 6099 295 2019-01-13 03:30 DK7FC 0.137620 -32 0 JN49ik 1 W1VD FN31ls 6099 295 2019-01-13 03:00 DK7FC 0.137620 -33 0 JN49ik 1 W1VD FN31ls 6099 295 2019-01-13 02:30 DK7FC 0.137620 -31 0 JN49ik 1 W1VD FN31ls 6099 295 2019-01-13 02:00 DK7FC 0.137620 -31 0 JN49ik 1 W1VD FN31ls 6099 295 2019-01-13 01:30 DK7FC 0.137620 -28 0 JN49ik 1 W1VD FN31ls 6099 295 2019-01-13 01:00 DK7FC 0.137620 -34 0 JN49ik 1 W1VD FN31ls 6099 295 2019-01-13 00:30 DK7FC 0.137620 -33 0 JN49ik 1 W1VD FN31ls 6099 295 BTW, 8270 kHz rx setup has been making files unimpeded for almost 3 weeks now ;~) . Jay W1VD