Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id wBSNt2Z2019824 for ; Sat, 29 Dec 2018 00:55:03 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gd1qJ-0000WU-EY for rs_out_1@blacksheep.org; Fri, 28 Dec 2018 23:47:03 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gd1mx-0000WH-08 for rsgb_lf_group@blacksheep.org; Fri, 28 Dec 2018 23:43:35 +0000 Received: from resqmta-ch2-07v.sys.comcast.net ([2001:558:fe21:29:69:252:207:39]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91_59-0488984) (envelope-from ) id 1gd1mn-0004wW-0s for rsgb_lf_group@blacksheep.org; Fri, 28 Dec 2018 23:43:26 +0000 Received: from resomta-ch2-16v.sys.comcast.net ([69.252.207.112]) by resqmta-ch2-07v.sys.comcast.net with ESMTP id d1LcgiANalCvDd1mhgpTqZ; Fri, 28 Dec 2018 23:43:19 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1546040599; bh=2G+P9mSjQtAw2qAUFKH19ckf3M9WdAuJmNlwm3G06yg=; h=Received:Received:From:Subject:To:Content-Type:Date:Message-ID; b=NmtxCrSexR4mv6sYRa+l0fZy06s2eHAlCe6OR1xjEWEtqM47GUOJG/zU2bjSQrKwx F130esBY6THW6b2L7nKbLhgz1glvaawAGy1C5UCGrwpdhMg/IkbdmzXYlqQcD1yUaO uOkADdepua7eXyi6ioWSa6nPKoGQXzVVwYaT7ftJYXF5schsjcXPDItVZun273JDFD 206Y1adiNCVmQfrYA6nJcG5d6g5FV8dyXhv/Q5qOqOe0eoeBiRVeI6KqQs3lLVTkMb pvzdn0Y0jrm5GzhdRZtqB2mf58wCHbshBf34ODByBGvpQX6gdJSnZKmgJbHOBH5B8q pUjg/55Fte/JQ== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-16v.sys.comcast.net with ESMTPSA id d1megUO9ocbBNd1mfgpOhX; Fri, 28 Dec 2018 23:43:18 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtledrtdejgddtjecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfenuceurghilhhouhhtmecufedttdenucenucfjughrpefhuffvtgfgfhffkfgjfgesthhqredttderjeenucfhrhhomhepfdhjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtfdcuoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucffohhmrghinhepfiduvhgurdgtohhmnecukfhppeejfedrgedrvdehfedrudegudenucfrrghrrghmpehhvghlohepqfhpthhiphhlvgigleektddqrfevpdhinhgvthepjeefrdegrddvheefrddugedupdhmrghilhhfrhhomhepjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdprhgtphhtthhopehrshhgsggplhhfpghgrhhouhhpsegslhgrtghkshhhvggvphdrohhrghenucevlhhushhtvghrufhiiigvpedt X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" References: <72b8d3b3-6f70-7d3c-5552-8376147fc9dd@n1bug.com> <1545951145862.61915@kuleuven.be> <1545954857943.39732@kuleuven.be> <1UQfq1ynWL.1bMjOcaSm0I@optiplex980-pc> <1546035718842.99086@kuleuven.be> <92e4d304-d96e-f581-f90f-b5d195bd4d5f@n1bug.com> Date: Fri, 28 Dec 2018 18:43:16 -0500 Message-ID: <1UQfq2qyVS.2By9s0LEb68@optiplex980-pc> In-Reply-To: <92e4d304-d96e-f581-f90f-b5d195bd4d5f@n1bug.com> User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Rik, Paul Didn't notice that file in extra subfolder ... was looking at the one in the main folder. Exactly what I was looking for. Thanks! Jay Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:39 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: 9ca91679b330d65f05d707c2d2b164fe Subject: Re: LF: Re: SlowJT9 Content-Type: text/plain; charset=utf-8 X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: X-Spam-Status: No, hits=0.0 required=5.0 tests=TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false Content-Transfer-Encoding: 8bit X-MIME-Autoconverted: from quoted-printable to 8bit by klubnl.pl id wBSNt2Z2019824 Rik, Paul Didn't notice that file in extra subfolder ... was looking at the one in the main folder. Exactly what I was looking for. Thanks! Jay ----- Original Message ----- From: N1BUG Reply-To: To: Sent: 12/28/2018 5:29:30 PM Subject: Re: LF: Re: SlowJT9 ________________________________________________________________________________ Jay, Did you look at the decoded.txt file in the /extra subfolder? Is that not what you want? 73, Paul On 12/28/18 5:21 PM, Rik Strobbe wrote: > ?Hello Jay, > > > adding an extra txt file would be no problem, but I am afraid I > don't understand in what way it should be different from the > current one? > > > 73, Rik ON7YD - OR7T > > > > ________________________________ Van: > owner-rsgb_lf_group@blacksheep.org > namens jrusgrove@comcast.net > Verzonden: vrijdag 28 december 2018 > 23:14 Aan: (rsgb_lf_group@blacksheep.org) Onderwerp: LF: SlowJT9 > > Rik > > Any chance you can add an extra decoded.txt file (different name > like all_decoded.txt) that is a running list of all decodes? This > file could then be uploaded at regular intervals with a simple > batch file to a page similar to http://www.w1vd.com/EbNaut.html . > This might be easier than G0LUJ's presentation of the decoder > GUIs ... and it would give the ability to scroll back in time. > Suppose it could be taken a step further by separating out the > decodes to different .txt files based on the different modes. > > I know your busy working on more important issues with the > program ... just something to think about for the future. > > Jay W1VD