Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id wBSMJl95019396 for ; Fri, 28 Dec 2018 23:19:53 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gd0OZ-0008WV-An for rs_out_1@blacksheep.org; Fri, 28 Dec 2018 22:14:19 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gd0OT-0008WM-K1 for rsgb_lf_group@blacksheep.org; Fri, 28 Dec 2018 22:14:13 +0000 Received: from resqmta-ch2-02v.sys.comcast.net ([2001:558:fe21:29:69:252:207:34]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91_59-0488984) (envelope-from ) id 1gd0OQ-0004lV-Lk for rsgb_lf_group@blacksheep.org; Fri, 28 Dec 2018 22:14:12 +0000 Received: from resomta-ch2-03v.sys.comcast.net ([69.252.207.99]) by resqmta-ch2-02v.sys.comcast.net with ESMTP id czrZgnZUMabcAd0OLgRJov; Fri, 28 Dec 2018 22:14:05 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1546035245; bh=kEAS6WKPQfQE9EHBP2yuCYMBgDrXcZJ4gAEmsZg2sdE=; h=Received:Received:From:Subject:To:Content-Type:MIME-Version:Date: Message-ID; b=B95t1PLg2N/rchUzZvP8EH55apsLVFWZAbMa5+rIxXb1987EAr+MgcYLt87IrtT5L JhM9DPa4og20uIZQz6ChuFs3D/7/mTLEG+nBVkcrkOq3hNe8iVTevkZlSy4vmQ+GAi yk2VTOuJQCVmiJdmpLva1Ur4aXMKoQiB3ojAwuGP2/94sz2pE+9mw9NeWI8ILI5CET LRF33MwsL5nQKStsGvHOU2ZkigmFdnGN6v6dvctdAcT3RYyWuOkd6IFftxNuj4rxvP N4Jn1LFYIJIHBkFSlNc/a8dzknYs4Lr/Rcab4QViMvqxRFtS1qGmsgAud2H2ov09we XuVkOnK/Sb5MQ== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-03v.sys.comcast.net with ESMTPSA id d0OKgfaekov77d0OLgUf8f; Fri, 28 Dec 2018 22:14:05 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtledrtdehgdduiedtucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuvehomhgtrghsthdqtfgvshhipdfqfgfvnecuuegrihhlohhuthemuceftddtnecuogfntfdquehouhhnugdqtfefvdculdehmdenucfjughrpefhuffvtgggfhffkfgjfgesrgdtreertderjeenucfhrhhomhepfdhjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtfdcuoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucffohhmrghinhepfiduvhgurdgtohhmnecukfhppeejfedrgedrvdehfedrudegudenucfrrghrrghmpehhvghlohepqfhpthhiphhlvgigleektddqrfevpdhinhgvthepjeefrdegrddvheefrddugedupdhmrghilhhfrhhomhepjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdprhgtphhtthhopehrshhgsggplhhfpghgrhhouhhpsegslhgrtghkshhhvggvphdrohhrghenucevlhhushhtvghrufhiiigvpedt X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" To: "(rsgb_lf_group@blacksheep.org)" MIME-Version: 1.0 References: <72b8d3b3-6f70-7d3c-5552-8376147fc9dd@n1bug.com> <1545951145862.61915@kuleuven.be> <1545954857943.39732@kuleuven.be> Date: Fri, 28 Dec 2018 17:14:04 -0500 Message-ID: <1UQfq1ynWL.1bMjOcaSm0I@optiplex980-pc> In-Reply-To: <1545954857943.39732@kuleuven.be> User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Rik Any chance you can add an extra decoded.txt file (different name like all_decoded.txt) that is a running list of all decodes? This file could then be uploaded at regular intervals with a simple batch [...] Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:34 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: 7ab87d4d3ea1d9dcb73a78e83fe4d608 Subject: LF: SlowJT9 Content-Type: multipart/alternative; boundary="fmWXMFlUoSQEnpQHaFfg3ObNG2etXWx=_p" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: X-Spam-Status: No, hits=0.5 required=5.0 tests=HTML_20_30,HTML_MESSAGE autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format --fmWXMFlUoSQEnpQHaFfg3ObNG2etXWx=_p Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline Rik Any chance you can add an extra decoded.txt file (different name like=20= all_decoded.txt) that is a running list of all decodes? This file coul= d then be=20 uploaded at regular intervals with a simple batch file to a page simil= ar to=20 http://www.w1vd.com/EbNaut.html . This might be easier than G0LUJ's pr= esentation of the decoder GUIs ... and it would give the ability to sc= roll back in time. Suppose it could be taken a step further by separat= ing out the decodes to different .txt files based on the different mod= es.=20 I know your busy working on more important issues with the program ...= just something to think about for the future. Jay W1VD =20 --fmWXMFlUoSQEnpQHaFfg3ObNG2etXWx=_p Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline
Rik
 
Any chance you can add an extra decoded.txt file (different = name like all_decoded.txt) that is a running list of all decodes? = ;This file could then be uploaded at regular intervals with = a simple batch file to a page similar to http://www.w1vd.com/EbNaut.html . This mi= ght be easier than G0LUJ's presentation of the decoder GUIs = =2E.. and it would give the ability to scroll back in time. Suppo= se it could be taken a step further by separating out the decodes= to different .txt files based on the different modes.
 
I know your busy working on more important issues with the progra= m ... just something to think about for the  future.
 
Jay W1VD   
--fmWXMFlUoSQEnpQHaFfg3ObNG2etXWx=_p--