Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id wBR4faE3006418 for ; Thu, 27 Dec 2018 05:41:38 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gcNMY-0001Dh-8Q for rs_out_1@blacksheep.org; Thu, 27 Dec 2018 04:33:38 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gcNMX-0001DY-KQ for rsgb_lf_group@blacksheep.org; Thu, 27 Dec 2018 04:33:37 +0000 Received: from resqmta-ch2-08v.sys.comcast.net ([2001:558:fe21:29:69:252:207:40]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91_59-0488984) (envelope-from ) id 1gcNMR-0008NN-VC for rsgb_lf_group@blacksheep.org; Thu, 27 Dec 2018 04:33:36 +0000 Received: from resomta-ch2-14v.sys.comcast.net ([69.252.207.110]) by resqmta-ch2-08v.sys.comcast.net with ESMTP id cNLVglMb5P91PcNMMguLMR; Thu, 27 Dec 2018 04:33:26 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1545885206; bh=eWDeFQSIYqkKuB5pGHRberyo+8MmlZyjhmAx5eAmvzI=; h=Received:Received:From:Subject:To:Content-Type:MIME-Version:Date: Message-ID; b=BOBKtBYJf95pQT1ZJDoXZ88Zv4m6wh3btDisTOcm/zHKKWoQNxuD0af44dunbtbMo jK/Q2VcbWQS555tGjTZyg+3dEEToQU7u2X4zsGMhX1WSr0yhP3UV93eVE/GwPVgs25 60VWyP7EZdI7CdLGsJQsz4/K8LYun9QzDhZePtB3yGv2BcPuTWPRhFYHASkWddwnju HLgm8T7NSDAgS3Pxc2KWYBracyQjjozgpsQGZ7F2Z9Sdy2lkSCNT5S6o/tbko4jtVd WGt92RXoysKRtxPzk/xoKH5HhLNyOd6Q3+IX7J7TdWl6qhHhPdzyX4QJD6j1hRP2z+ 1YBttxHhUERvA== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-14v.sys.comcast.net with ESMTPSA id cNMKg3afMic2ucNMLgz15X; Thu, 27 Dec 2018 04:33:26 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtledrtddugdejfecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfenuceurghilhhouhhtmecufedttdenucgonfftqdeuohhunhguqdftfedvucdlhedmnecujfgurhephffuvfgtggffkfgfsegrtderredtreejnecuhfhrohhmpedfjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdfuceojhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvtheqnecuffhomhgrihhnpeifudhvugdrtghomhenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopefqphhtihhplhgvgielkedtqdfrvedpihhnvghtpeejfedrgedrvdehfedrudeguddpmhgrihhlfhhrohhmpehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtpdhrtghpthhtoheplhhofihfvghrsehmrghilhhmrghnrdhqthhhrdhnvghtpdhrtghpthhtoheprhhsghgspghlfhgpghhrohhuphessghlrggtkhhshhgvvghprdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" To: "(lowfer@mailman.qth.net)" , "(rsgb_lf_group@blacksheep.org)" MIME-Version: 1.0 Date: Wed, 26 Dec 2018 23:33:24 -0500 Message-ID: <1UQfnuooLL.3JtD9OHxwlq@optiplex980-pc> User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: EbNaut enthusiasts Last week Markus posted his log of recent EbNaut receptions ... it was interesting to see the activity / receptions from the EU side of the pond. For those that might be interested in activity / recep [...] Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:40 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: 5f132ffce194fb93f2267a462d849f2b Subject: LF: EbNaut receptions Content-Type: multipart/alternative; boundary="2wehGm2nUOdRnNuTfYGGRg7GdbF=_UIUdy" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: X-Spam-Status: No, hits=0.8 required=5.0 tests=HTML_30_40,HTML_MESSAGE autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format --2wehGm2nUOdRnNuTfYGGRg7GdbF=_UIUdy Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline EbNaut enthusiasts Last week Markus posted his log of recent EbNaut receptions ... it was= =20 interesting to see the activity / receptions from the EU side of the p= ond. For=20 those that might be interested in activity / receptions from the US si= de, a=20 listing of recent receptions can be found at http://www.w1vd.com/EbNau= t.html .=20 Thanks to all transmitting stations for your efforts! Jay W1VD =20 --2wehGm2nUOdRnNuTfYGGRg7GdbF=_UIUdy Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline
EbNaut enthusiasts
 
Last week Markus posted his log of recent EbNaut receptions = =2E.. it was interesting to see the activity / receptions fr= om the EU side of the pond. For those that might be interested in acti= vity / receptions from the US side, a listing of recent rece= ptions can be found at http://www.w1vd.com/EbNaut.html .
 
Thanks to all transmitting stations for your efforts!
 
Jay W1VD        
--2wehGm2nUOdRnNuTfYGGRg7GdbF=_UIUdy--