Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id wBPM0H3L026545 for ; Tue, 25 Dec 2018 23:00:23 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gbufi-0004DH-Ht for rs_out_1@blacksheep.org; Tue, 25 Dec 2018 21:55:30 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gbufi-0004D8-1x for rsgb_lf_group@blacksheep.org; Tue, 25 Dec 2018 21:55:30 +0000 Received: from resqmta-ch2-04v.sys.comcast.net ([2001:558:fe21:29:69:252:207:36]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91_59-0488984) (envelope-from ) id 1gbuff-00057I-Mc for rsgb_lf_group@blacksheep.org; Tue, 25 Dec 2018 21:55:28 +0000 Received: from resomta-ch2-05v.sys.comcast.net ([69.252.207.101]) by resqmta-ch2-04v.sys.comcast.net with ESMTP id buKCgr45l8iiqbufbgigvm; Tue, 25 Dec 2018 21:55:23 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1545774923; bh=2kHB/cLcozgjaXZXVMvji+pKGERN4l6qhoiQLt7sZ8s=; h=Received:Received:From:Subject:To:Content-Type:Date:Message-ID; b=o+Mcq18G0MtuaDSyy2prufW9zKj5qaohwjBzHgvaXEgK4KkcxA7LvejN8xFEVKFa0 XeoKm3z7xhL7oMCSXKT6KF2UVN1Dj6RJ4ycT4ayXylaxFCkb/gptroK3jurSaq0qUx T13ivkN1nydMzEB518cuGCMCCjJwfv6LKIxiyQCJvzAmwPdpvd6SpGxL0ksLDMb7s4 QUoS2zswFCDAXqGvOz0844s5VCRSvfzYl42jFqz+e+0BjCAp4KindBujSWCwV1BCc1 FF0Sf2TPOz++RbFNbx2H83JAG5ivLLupa2dba7mg1IoqeMcJhpL87jnJpGOe6WI+BG 23ObCBxNaMYoQ== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-05v.sys.comcast.net with ESMTPSA id bufZgRrpgF3ztbufagcrfX; Tue, 25 Dec 2018 21:55:22 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtkedrudekfedgudehlecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfenuceurghilhhouhhtmecufedttdenucenucfjughrpefhuffvtgfgfhffkfgjfgesthhqredttderjeenucfhrhhomhepfdhjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtfdcuoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopefqphhtihhplhgvgielkedtqdfrvedpihhnvghtpeejfedrgedrvdehfedrudeguddpmhgrihhlfhhrohhmpehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtpdhrtghpthhtoheprhhsghgspghlfhgpghhrohhuphessghlrggtkhhshhgvvghprdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" References: Date: Tue, 25 Dec 2018 16:55:21 -0500 Message-ID: <1UQfmkYQ47.6cZhdo2MMCt@optiplex980-pc> In-Reply-To: User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Joe Didn't get a chance to check last night but good copy mid day and this afternoon. 12/25/18 VO1NA 137477 8K19A CRC16 3 sec sym 7 char Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:36 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: 64437c466041e93ffedda7fb96b22b71 Subject: Re: LF: EbNaut 2200m Content-Type: text/plain; charset=utf-8 X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: X-Spam-Status: No, hits=0.0 required=5.0 tests=TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false Content-Transfer-Encoding: 8bit X-MIME-Autoconverted: from quoted-printable to 8bit by klubnl.pl id wBPM0H3L026545 Joe Didn't get a chance to check last night but good copy mid day and this afternoon. 12/25/18 VO1NA 137477 8K19A CRC16 3 sec sym 7 char 1600z Rank 0 Eb/Naut 16.4 dB PHOTON 1700z Rank 0 Eb/Naut 15.4 dB PHOTON 1800z Rank 0 Eb/Naut 15.4 dB PHOTON 1900z Rank 0 Eb/Naut 10.3 dB MX &HNY 2000z Rank 0 Eb/Naut 12.0 dB MX &HNY Nice not to have to keep track of the 244 uHz frequency offset ;-) . Jay W1VD ----- Original Message ----- From: Reply-To: To: Sent: 12/24/2018 10:16:00 AM Subject: LF: EbNaut 2200m ________________________________________________________________________________ It seems the gps derived carrier is behaving itself so let's try: 137.477 kHz, 7 Chars, 8K19A, 3 s symbols, 608 symbols, starting 1600 ut and at 1 hr intervals, 50 watts to the momopole. 73 Joe VO1NA