Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id wBO8v8eE013380 for ; Mon, 24 Dec 2018 09:57:16 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gbLui-0008Qw-Lk for rs_out_1@blacksheep.org; Mon, 24 Dec 2018 08:48:40 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gbLsK-0008Qd-Al for rsgb_lf_group@blacksheep.org; Mon, 24 Dec 2018 08:46:12 +0000 Received: from resqmta-ch2-12v.sys.comcast.net ([2001:558:fe21:29:69:252:207:44]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91_59-0488984) (envelope-from ) id 1gbLsD-0001Tk-Re for rsgb_lf_group@blacksheep.org; Mon, 24 Dec 2018 08:46:11 +0000 Received: from resomta-ch2-01v.sys.comcast.net ([69.252.207.97]) by resqmta-ch2-12v.sys.comcast.net with ESMTP id bLrJg9WWdr9eqbLs8gLkOC; Mon, 24 Dec 2018 08:46:00 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1545641160; bh=i9FboNCwndWQt3Hz6Tx4CC/IDE5iHAm8+aM3oh/j/cg=; h=Received:Received:From:Subject:To:Content-Type:MIME-Version:Date: Message-ID; b=At63zmizrg/+DAuz1ju/JnzuSp+Kdj3S6Qyf/So+feZhtynVHdlauBKsgp6NYtBH7 EobUUrAQdcuak8umNhkSXLfOhWJK2XE5AQdix238DVbK5YlNjMonQpUJ9+ponl59oZ t3KXb9kSOgCDq5IlvrHHASoGjvE4ydfGGaFaDa1wptUwRigDdAvAuywAqSEi6QVAHY gQZ18qQ37gu/fOmUk1jHs2IbpXJmGMGlX/txOuPj605AolVRPgENg89M0LNcPrvOf/ gAAA6KFIBMd6+QWfGA8zofFMJ9BuxmUNQtF81CeekzgRey8HXZNHbQl9yrROux5vgi Dt6MNuGL5iXhA== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-01v.sys.comcast.net with ESMTPSA id bLs6gfvfb1tfebLs7g9CWF; Mon, 24 Dec 2018 08:46:00 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtkedrudektddguddvfecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfenuceurghilhhouhhtmecufedttdenucgonfftqdeuohhunhguqdftfedvucdlhedmnecujfgurhephffuvfgtggffkfgfsegrtderredtreejnecuhfhrohhmpedfjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdfuceojhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvtheqnecuffhomhgrihhnpeifudhvugdrtghomhenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopefqphhtihhplhgvgielkedtqdfrvedpihhnvghtpeejfedrgedrvdehfedrudeguddpmhgrihhlfhhrohhmpehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtpdhrtghpthhtoheprhhsghgspghlfhgpghhrohhuphessghlrggtkhhshhgvvghprdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" To: "(rsgb_lf_group@blacksheep.org)" MIME-Version: 1.0 Date: Mon, 24 Dec 2018 03:45:58 -0500 Message-ID: <1UQflW10ql.BE2LuEhUBWC@optiplex980-pc> User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: SAQ Enthusiasts Excellent copy of SAQ this morning ... one of the best all time receptions for this location. Static levels were low to moderate. A short clip from tune up and message at: http://www.w1vd.com/SAQ122418.mp3 Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:44 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: 3f8d74a8c70dd416d0a3a1dbcb9bb89f Subject: LF: SAQ 17.2 kHz in CT Content-Type: multipart/alternative; boundary="WG4ObViB=_QLN7fSqhyJQTWqGUxYjWvOne" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: X-Spam-Status: No, hits=0.8 required=5.0 tests=HTML_30_40,HTML_MESSAGE autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format --WG4ObViB=_QLN7fSqhyJQTWqGUxYjWvOne Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline SAQ Enthusiasts Excellent copy of SAQ this morning ... one of the best all time recept= ions for=20 this location. Static levels were low to moderate. A short clip from t= une up=20 and message at: http://www.w1vd.com/SAQ122418.mp3 Equipment setup: modified AMRAD e probe, LNA, Delta 44 A/D, Spectrum L= aboratory. Jay W1VD Burlington CT USA --WG4ObViB=_QLN7fSqhyJQTWqGUxYjWvOne Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline
SAQ Enthusiasts
 
Excellent copy of SAQ this morning ... one of the best all time r= eceptions for this location. Static levels were low to moderate. A sho= rt clip from tune up and message at:
 
 
Equipment setup: modified AMRAD e probe, LNA, Delta 44 A/D, Spect= rum Laboratory.
 
Jay W1VD
Burlington CT USA
--WG4ObViB=_QLN7fSqhyJQTWqGUxYjWvOne--