Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id wBNLUgiD009529 for ; Sun, 23 Dec 2018 22:30:50 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gbBFp-0007Is-RM for rs_out_1@blacksheep.org; Sun, 23 Dec 2018 21:25:45 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gbBFi-0007Ij-OS for rsgb_lf_group@blacksheep.org; Sun, 23 Dec 2018 21:25:38 +0000 Received: from resqmta-ch2-09v.sys.comcast.net ([2001:558:fe21:29:69:252:207:41]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91_59-0488984) (envelope-from ) id 1gbBFg-0000KI-RV for rsgb_lf_group@blacksheep.org; Sun, 23 Dec 2018 21:25:37 +0000 Received: from resomta-ch2-14v.sys.comcast.net ([69.252.207.110]) by resqmta-ch2-09v.sys.comcast.net with ESMTP id bAhkgR49Iv39JbBFagaE7o; Sun, 23 Dec 2018 21:25:30 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1545600330; bh=lWc7INr5JeVySyn07yvpUHU5JPBLFnR0bFLrDsLFogU=; h=Received:Received:From:Subject:To:Content-Type:MIME-Version:Date: Message-ID; b=SCi2BsEJtC3Cx6GGkneRjpwe2yAg6huTbzBDAcGEcf/KyN54GAw4ozE5rx26e/Eeo A/kGyc8VcW/VbCYIGJdufnEeuciwP1MuQ4FZIH9ASTxoz6gEHuwvMvi/HzTJYQIh0G KZ6POqHqd49SUVfjkNL6iJWE1QfSuCYiKF7GTNfB+SMMXAwOOYugVDDoZ7WvKj+eYp ch8sQG6vuGNrGU7o7QdmRU/gi88Pr8rRwgHmOo8oKM8EBB0HFXPelNmBfIpKLhS/C6 n3ldfQnUeEjdiJIhH5Yb3PdzfatOPuK59GlzJmOdCjLVZO1jn2IdrGt8lFidtzQ2JF JD5l6VEGAnQ1g== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-14v.sys.comcast.net with ESMTPSA id bBFYgqMQFic2ubBFYgvIIJ; Sun, 23 Dec 2018 21:25:30 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtkedrudejledgudehvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfenuceurghilhhouhhtmecufedttdenucgonfftqdeuohhunhguqdftfedvucdlhedmnecujfgurhephffuvfgtgghffffkjggfsegrtderredtreejnecuhfhrohhmpedfjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdfuceojhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvtheqnecukfhppeejfedrgedrvdehfedrudegudenucfrrghrrghmpehhvghlohepqfhpthhiphhlvgigleektddqrfevpdhinhgvthepjeefrdegrddvheefrddugedupdhmrghilhhfrhhomhepjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdprhgtphhtthhopehrshhgsggplhhfpghgrhhouhhpsegslhgrtghkshhhvggvphdrohhrghenucevlhhushhtvghrufhiiigvpedt X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" MIME-Version: 1.0 References: <1UQfkVjmR8.3WVndwob1GH@optiplex980-pc> Date: Sun, 23 Dec 2018 16:25:27 -0500 Message-ID: <1UQfkZ03uu.4b5ybHUWU4a@optiplex980-pc> In-Reply-To: User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Riccardo Always happy to look. So far I only have only one reception of your station back on 11/15. Will be looking to decode your signal in the future. Jay W1VD Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:41 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: 1273381c241b4bc851b7e848e0897dc9 Subject: Re: LF: IW4DXW IZ7SLZ EbNaut Content-Type: multipart/alternative; boundary="n4EcDUemTIomVKJdlj=_cB2mdc7Hm44ECF" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: * X-Spam-Status: No, hits=1.2 required=5.0 tests=HTML_50_60,HTML_MESSAGE, MAILTO_TO_SPAM_ADDR,TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format --n4EcDUemTIomVKJdlj=_cB2mdc7Hm44ECF Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline Riccardo Always happy to look. So far I only have only one reception of your st= ation=20 back on 11/15. Will be looking to decode your signal in the future. Jay W1VD =20 ----- Original Message ----- From: Riccardo Zoli Reply-To: To: LF Group Sent: 12/23/2018 1:35:42 PM Subject: Re: LF: IW4DXW IZ7SLZ EbNaut Many thanks, Jay, for your efforts. On 137540, last night 5 transmissi= ons=20 completed by my side: [UTC] 01:30 02:30 03:30 04:30 05:30 =2E..then high ROS due to fog has tripped my TX. All the best Mri Xmas 73 de Riccardo IW4DXW Il giorno Dom 23 Dic 2018, 17:46 jrusgrove@comcast.net =20 ha scritto: Sadly, no receptions to report last night. Jay W1VD --n4EcDUemTIomVKJdlj=_cB2mdc7Hm44ECF Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline
Riccardo
 
Always happy to look. So far I only have only one reception of yo= ur station back on 11/15. Will be looking to decode your signal in the= future.
 
Jay W1VD
 
 
 
 
----- Original Message -----
From: Riccardo Zoli <riccardozoli80@gmail.com>
Sent: 12/23/2018 1:35:42 PM
Subject: Re: LF: IW4DXW IZ7SLZ EbNaut

Many thanks, Jay, for your efforts. On 137540, last night 5 trans= missions completed by my side:
[UTC]
01:30
02:30
03:30
04:30
05:30
...then high ROS due to fog has tripped my TX.

All the best
Mri Xmas
73

de Riccardo IW4DXW


Il giorno Dom 23 Dic 2018, 17:46 jrusgrove@comcast.= net <jrusgrove@comcast.net> ha scritto:
Sadly, no receptions to report last night.
 
Jay W1VD
<= /BODY> --n4EcDUemTIomVKJdlj=_cB2mdc7Hm44ECF--