Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id wBL0L7sO021483 for ; Fri, 21 Dec 2018 01:21:13 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1ga8TB-0001LK-T1 for rs_out_1@blacksheep.org; Fri, 21 Dec 2018 00:15:13 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1ga8S5-0001L9-OE for rsgb_lf_group@blacksheep.org; Fri, 21 Dec 2018 00:14:05 +0000 Received: from resqmta-ch2-08v.sys.comcast.net ([2001:558:fe21:29:69:252:207:40]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91_59-0488984) (envelope-from ) id 1ga8S0-0001At-ON for rsgb_lf_group@blacksheep.org; Fri, 21 Dec 2018 00:14:02 +0000 Received: from resomta-ch2-02v.sys.comcast.net ([69.252.207.98]) by resqmta-ch2-08v.sys.comcast.net with ESMTP id a87ggepAxP91Pa8RvgiPb6; Fri, 21 Dec 2018 00:13:55 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1545351235; bh=mmfY2Os3gVf3coK6qIHSyDoDyhGlAXITkCVsB3VtSBA=; h=Received:Received:From:Subject:To:Content-Type:MIME-Version:Date: Message-ID; b=UOQEpBI5RwgHxQU6CabCcyIcV0fhGlr4E4LquQnDLpiF4QX/4q06QSjH5mA7Vl2pX jP3G385Co1d+0+miy1nMhVAw6CTrsgwLiDVo/cJ/i0gKciCwgvZBf3At8rKV9L4Pxr dwGnXk1Octi6I8Hxt6rhg5R0HoQJom3MXAOeylWkgiUKfGHpAcJtbzKpYS9cDCfc/y XW4qLgbv9SNqcyDKFeLJhLeGS4Ige6/XNJLqbhCuaICB1+m06jGAeQcm4t9o98uYVM eIgeGVCCF1fhMcf+gaQ3F56PJVLiZrFmcrkU0ocJIG2YxY8i5NeREQXutrXmUxSI+3 WwWEqJZEuNMuw== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-02v.sys.comcast.net with ESMTPSA id a8RsgRiZVk82Za8RtgXS1F; Fri, 21 Dec 2018 00:13:54 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtkedrudejgedgudeiucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuvehomhgtrghsthdqtfgvshhipdfqfgfvnecuuegrihhlohhuthemuceftddtnecuogfntfdquehouhhnugdqtfefvdculdehmdenucfjughrpefhuffvtgggfhffkfgjfgesrgdtreertderjeenucfhrhhomhepfdhjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtfdcuoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopefqphhtihhplhgvgielkedtqdfrvedpihhnvghtpeejfedrgedrvdehfedrudeguddpmhgrihhlfhhrohhmpehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtpdhrtghpthhtoheprhhsghgspghlfhgpghhrohhuphessghlrggtkhhshhgvvghprdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" MIME-Version: 1.0 References: <5C1C1005.7010609@posteo.de> Date: Thu, 20 Dec 2018 19:13:52 -0500 Message-ID: <1UQfhJvJV8.OTVQeLstffw@optiplex980-pc> In-Reply-To: User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Riccardo Sorry but there is no chance for a reception here tonight ... a major storm is moving up the east coast and QRN is brutal. Will be looking for your messages in the future. Jay W1VD Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:40 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: e51657317b06d9cbe905ec682fad6602 Subject: Re: LF: LF EbNaut transmission from JN64 Content-Type: multipart/alternative; boundary="iKiBcmJnE9w1=_xv2MT7mnHGcj1DqMBuXU" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: * X-Spam-Status: No, hits=1.9 required=5.0 tests=HTML_30_40,HTML_MESSAGE, MAILTO_TO_SPAM_ADDR,TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format --iKiBcmJnE9w1=_xv2MT7mnHGcj1DqMBuXU Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline Riccardo Sorry but there is no chance for a reception here tonight ... a major = storm is=20 moving up the east coast and QRN is brutal. Will be looking for your m= essages=20 in the future. Jay W1VD=20 ----- Original Message ----- From: Riccardo Zoli Reply-To: To: LF Group Sent: 12/20/2018 5:20:17 PM Subject: Re: LF: LF EbNaut transmission from JN64 Hi Stefan, Many thanks, as usual, for your quick decode. I think that glitch was caused by a manual resync of the SR calibratio= n block=20 in SpecLab. GN & 73 de Riccardo IW4DXW P.S.: congratulations for your fantastic achievements in SLF toward th= e DC! Il giorno Gio 20 Dic 2018, 22:59 DK7FC ha scr= itto: Hi Riccardo, No problem to decode but it looks like there was a phase glitch in the= =20 transmission starting 21 UTC. 73, Stefan Am 20.12.2018 22:12, schrieb Riccardo Zoli: > > Hi LF. > > If you want to try to decode my message tonite, the parameters are a= s=20 > follows: > > Start time: 20 Dec. 2100 UTC; last transmission: 21 Dec. 07:00 UTC, > (repeated every 30 min.) > > QRG: 137540 Hz > Coding: 8K19A > CRC 4 > 15 characters > 2 sec./sym. > Duration: 29' 52" > 250 mW ERP > > Reports are welcome! > > All the best > > > 73 de Riccardo IW4DXW > > --iKiBcmJnE9w1=_xv2MT7mnHGcj1DqMBuXU Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline
Riccardo
 
Sorry but there is no chance for a reception here tonight ...&nbs= p;a major storm is moving up the east coast and QRN is brutal. Wi= ll be looking for your messages in the future.
 
Jay W1VD 
 
 
----- Original Message -----
From: Riccardo Zoli <riccardozoli80@gmail.com>
Sent: 12/20/2018 5:20:17 PM
Subject: Re: LF: LF EbNaut transmission from JN64

Hi Stefan,

Many thanks, as usual, for your quick decode.
I think that glitch was caused by a manual resync of the SR calib= ration block in SpecLab.

GN & 73 de Riccardo IW4DXW



P.S.: congratulations for your fantastic achievements in SLF towa= rd the DC!


Il giorno Gio 20 Dic 2018, 22:59 DK7FC <selberd= enken@posteo.de> ha scritto:
Hi Riccardo,

No p= roblem to decode but it looks like there was a phase glitch in the transmission starting 21 UTC.

73, Stefan

Am 20.12.2018 = 22:12, schrieb Riccardo Zoli:
>
> Hi LF.
>
> I= f you want to try to decode my message tonite, the parameters are as <= BR>> follows:
>
> Start time: 20 Dec. 2100 UTC; last tr= ansmission: 21 Dec. 07:00 UTC,
> (repeated every 30 min.)
>= ;
> QRG: 137540 Hz
> Coding: 8K19A
> CRC 4
> 1= 5 characters
> 2 sec./sym.
> Duration: 29' 52"
> 250= mW ERP
>
> Reports are welcome!
>
> All the b= est
>
>
> 73 de Riccardo IW4DXW
>
>
<= /BLOCKQUOTE>
--iKiBcmJnE9w1=_xv2MT7mnHGcj1DqMBuXU--