Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id wBJCITrX010759 for ; Wed, 19 Dec 2018 13:18:37 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gZajc-0006JR-NJ for rs_out_1@blacksheep.org; Wed, 19 Dec 2018 12:13:56 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gZajb-0006JI-47 for rsgb_lf_group@blacksheep.org; Wed, 19 Dec 2018 12:13:55 +0000 Received: from resqmta-ch2-05v.sys.comcast.net ([2001:558:fe21:29:69:252:207:37]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91_59-0488984) (envelope-from ) id 1gZajY-0005Tc-FG for rsgb_lf_group@blacksheep.org; Wed, 19 Dec 2018 12:13:53 +0000 Received: from resomta-ch2-02v.sys.comcast.net ([69.252.207.98]) by resqmta-ch2-05v.sys.comcast.net with ESMTP id ZaMWgUC3Xixl2ZajRgMvCT; Wed, 19 Dec 2018 12:13:45 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1545221625; bh=14lFqZ/FWMK0+c8MdQJ7s2iG366N/QN/FJSnyPf/Kr0=; h=Received:Received:From:Subject:To:Content-Type:Date:Message-ID; b=cyXyKOxt+piUS2WELP1E9FpL+/jDp55ZToHpgSH+KeZMV7PvIMV8R/GfL6sLEasHa rIYalkPmWPHLNetDXd4BfDvtxJLz9qW53gpvgIabF7lI5OwvX6rsmAtZ/LPkCC4FZL xGmDGiQtd5nqiy+OB+euSl5j6WzrUP/oimzly9nz9JnTNSks1bjd6hjxcOo6sIc5Od vgTvdXNSg24OrgTM8uioVKeVlNXywBOYRXNaYucAeUMWePYUlS3G4IBKnraB2KD9yp bx5TXUgBGcuMetQDGNSTXUPwFY2FsZJkBfqAgfZB8k+644zop5bPGyX3rSM0GgMT7B zc07ODe6sIe5g== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-02v.sys.comcast.net with ESMTPSA id ZajPgJiK4k82ZZajQgUdc5; Wed, 19 Dec 2018 12:13:45 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtkedrudejtddgfeekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuvehomhgtrghsthdqtfgvshhipdfqfgfvnecuuegrihhlohhuthemuceftddtnecunecujfgurhephffuvfgtgfhffffkjggfsehtqhertddtreejnecuhfhrohhmpedfjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdfuceojhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvtheqnecukfhppeejfedrgedrvdehfedrudegudenucfrrghrrghmpehhvghlohepqfhpthhiphhlvgigleektddqrfevpdhinhgvthepjeefrdegrddvheefrddugedupdhmrghilhhfrhhomhepjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdprhgtphhtthhopehrshhgsggplhhfpghgrhhouhhpsegslhgrtghkshhhvggvphdrohhrghenucevlhhushhtvghrufhiiigvpedt X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" References: <10f465fa-37f0-4ac6-b53d-793f955ea011@email.android.com> <5C19FFCB.1060305@posteo.de> <0E0AEF52-CE89-4E56-A2E1-77C2F9815B4B@md.metrocast.net> Date: Wed, 19 Dec 2018 07:13:43 -0500 Message-ID: <1UQfg67rx6.IMDdZFyOLi5@optiplex980-pc> In-Reply-To: <0E0AEF52-CE89-4E56-A2E1-77C2F9815B4B@md.metrocast.net> User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: > Additional thoughts and suggestions are welcome. If using an untuned loop or e probe antenna (any untuned antenna for that matter) you'll want to include a front end filter to remove the image. Even if there are no signals at the image frequency you [...] Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:37 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: 32d4aaaf019758ff5a0d8e92eec683e6 Subject: Re: LF: Ebnaut receiver frequency stability qustion Content-Type: text/plain; charset=utf-8 X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: X-Spam-Status: No, hits=0.0 required=5.0 tests=TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false Content-Transfer-Encoding: 8bit X-MIME-Autoconverted: from quoted-printable to 8bit by klubnl.pl id wBJCITrX010759 > Additional thoughts and suggestions are welcome. If using an untuned loop or e probe antenna (any untuned antenna for that matter) you'll want to include a front end filter to remove the image. Even if there are no signals at the image frequency you still don't want the noise contribution. Jay W1VD ----- Original Message ----- From: Rob Renoud Reply-To: To: Sent: 12/19/2018 6:58:56 AM Subject: Re: LF: Ebnaut receiver frequency stability qustion ________________________________________________________________________________ Hi Stefan, Luis, LF EbNaut, There are several who believe the converter circuit approach is a viable path to EbNaut RX capability. I think three things are needed at this point: 1) Circuits 2) Identification of suitable Local Oscillator hardware (possibly for both RX and TX) 3) Clear and concise software configuration and operation instructions for Spectrum Lab, EbNaut-tx, EbNaut-rx, etc. Toward that end, I will set up a converter circuit and begin tests using K3SIW’s LowFER EbNaut beacon on 185.185... kHz with the goal of producing EbNaut configuration and operation instructions for the converter approach. Additional thoughts and suggestions are welcome. 73, Rob - K3RWR > On Dec 19, 2018, at 03:22, DK7FC wrote: > > Hi Luis, LF, > > I agree, this is indeed the most reasonable design. Using the same here ;-) but a 125 kHz LO, locked to GPS. > Maybe we should provide easy converter crcuits. A compromise between high end and easy to build up, for the 'EbNaut-newcomers'? > > 73, Stefan > > Am 19.12.2018 07:39, schrieb VIGILANT Luis Fernández: >> >> Hi EbNaut >> >> I think that using expensive receivers is NOT the way to go. I'm using a simple mixer as downconverter. The LO is 120KHz generated from a uBlox GPS. So the 137KHz outputs as 17KHz and can be feeded to PC soundcard. The second channel of GPS provides 1pps to discipline the soundcard using Spectrum lab >> >> Not using filters at all and no amplifier stages. So there is room for improvement, but it works >> >> 73 de Luis >> EA5DOM