Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id wBGINrtm020985 for ; Sun, 16 Dec 2018 19:24:00 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gYazX-00081L-Jj for rs_out_1@blacksheep.org; Sun, 16 Dec 2018 18:18:15 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gYazU-00081C-V9 for rsgb_lf_group@blacksheep.org; Sun, 16 Dec 2018 18:18:12 +0000 Received: from resqmta-ch2-01v.sys.comcast.net ([2001:558:fe21:29:69:252:207:33]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91_59-0488984) (envelope-from ) id 1gYazS-0006X3-99 for rsgb_lf_group@blacksheep.org; Sun, 16 Dec 2018 18:18:11 +0000 Received: from resomta-ch2-10v.sys.comcast.net ([69.252.207.106]) by resqmta-ch2-01v.sys.comcast.net with ESMTP id YaxugmjipKHJ2YazNgx2ub; Sun, 16 Dec 2018 18:18:05 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1544984285; bh=Jvlgqxn0xagSvg/ylpA7ywkpYkFTaOdoRrdYC8pZZp0=; h=Received:Received:From:Subject:To:Content-Type:MIME-Version:Date: Message-ID; b=anLkULeIaCaY5OSSGzdrNq3jbQnEBPSDJrbefmfJfs3QLoG2QDH8Cf2KIYEXSLxNk QJBLlBrDFbqyKYpGdC9WOCmEr1xewKDimYVGFtfBebbMNMPtDdH7gglBK6UR4ljtqn /5/tPOLFbtuOdA7r5N5H9z1/Cc9KFzKxGH3i2dgsgcCHxOgfUwZqiXe9pDuBMQFVfJ lTfYW15cJ1nL1t+/wo17ZpEhSvT7xahbP2jxKsprjKsxKJVeijWVYkSeLjWtvOCwU/ D6jFVRF0baPeuiVcWkiP+fFp4pumlCpv2w0BM88ki7HdJHmGQQGd++q4IuXS9qZAqU fK0LpOV07WGKA== Received: from Optiplex980-PC ([73.4.253.141]) by resomta-ch2-10v.sys.comcast.net with ESMTPSA id YazLg48iBMv5DYazMgqGYI; Sun, 16 Dec 2018 18:18:04 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtkedrudehledgudduvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfenuceurghilhhouhhtmecufedttdenucgonfftqdeuohhunhguqdftfedvucdlhedmnecujfgurhephffuvfgtgghffffkjggfsegrtderredtreejnecuhfhrohhmpedfjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdfuceojhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvtheqnecukfhppeejfedrgedrvdehfedrudegudenucfrrghrrghmpehhvghlohepqfhpthhiphhlvgigleektddqrfevpdhinhgvthepjeefrdegrddvheefrddugedupdhmrghilhhfrhhomhepjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdprhgtphhtthhopehrshhgsggplhhfpghgrhhouhhpsegslhgrtghkshhhvggvphdrohhrghenucevlhhushhtvghrufhiiigvpedt X-Xfinity-VMeta: sc=0;st=legit From: "jrusgrove@comcast.net" To: "rsgb_lf_group@blacksheep.org" MIME-Version: 1.0 References: <1120354998.5123331.1544978884379.ref@mail.yahoo.com> <1120354998.5123331.1544978884379@mail.yahoo.com> Date: Sun, 16 Dec 2018 13:18:03 -0500 Message-ID: <1UQfctBrIV.6Y22DJYTCkC@optiplex980-pc> In-Reply-To: <1120354998.5123331.1544978884379@mail.yahoo.com> User-Agent: OEClassic/2.9 (Win7.7601; P; 2018-07-03) X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Markus Will be looking for your messages ... thanks for the early heads up! Jay W1VD Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:33 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: 8ef270cc2ec30cd34b6313d7ada17a45 Subject: Re: LF: EbNaut 137.542 kHz Content-Type: multipart/alternative; boundary="=_11P14cNtNI9aA3KJW6ITmgZ4WboMA2Sx" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: X-Spam-Status: No, hits=0.5 required=5.0 tests=HTML_40_50,HTML_MESSAGE, TO_ADDRESS_EQ_REAL autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format --=_11P14cNtNI9aA3KJW6ITmgZ4WboMA2Sx Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline Markus Will be looking for your messages ... thanks for the early heads up! Jay W1VD ----- Original Message ----- From: Markus Vester Reply-To: To: Sent: 12/16/2018 11:48:04 AM Subject: LF: EbNaut 137.542 kHz Tonight I intend to send a number of different EbNaut messages, commem= orating a=20 scientific experiment which ended up changing the world. Frequency: 137542 Hz Start times: odd half hours (plus 0.3 s extra delay), Dec 16) 23:30 to= Dec 17,=20 6:30 UT=20 Format: 7 characters, 3 second symbols, 8K19A, CRC 15 (!) Duration: 30:00 minutes Radiated power: ~ 0.4 Watts Best 73, Markus (DF6NM) =20 --=_11P14cNtNI9aA3KJW6ITmgZ4WboMA2Sx Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline
Markus
 
Will be looking for your messages ... thanks for the early heads = up!
 
Jay W1VD
 
 
----- Original Message -----
From: Markus Vester <markusvester@aol.com>
Sent: 12/16/2018 11:48:04 AM
Subject: LF: EbNaut 137.542 kHz
Tonight I intend to send a number of diffe= rent EbNaut messages, commemorating a scientific experiment which= ended up changing the world.

Frequency: 137542 Hz
Start tim= es: odd half hours (plus 0.3 s extra delay), Dec 16) 23= :30 to Dec 17, 6:30 UT
Format: 7 characters, 3 second symbols= , 8K19A, CRC 15 (!)
Duration: 30:00 minutes
Radiated power: ~ 0.= 4 Watts

Best 73,
Markus (DF6NM)
 
<= /DIV>
--=_11P14cNtNI9aA3KJW6ITmgZ4WboMA2Sx--