Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id wBKM0N6g020705 for ; Thu, 20 Dec 2018 23:00:29 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1ga6JP-0008Dd-74 for rs_out_1@blacksheep.org; Thu, 20 Dec 2018 21:56:59 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1ga6JO-0008DU-Ub for rsgb_lf_group@blacksheep.org; Thu, 20 Dec 2018 21:56:58 +0000 Received: from resqmta-ch2-04v.sys.comcast.net ([2001:558:fe21:29:69:252:207:36]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91_59-0488984) (envelope-from ) id 1ga6JM-0000qa-V0 for rsgb_lf_group@blacksheep.org; Thu, 20 Dec 2018 21:56:57 +0000 Received: from resomta-ch2-04v.sys.comcast.net ([69.252.207.100]) by resqmta-ch2-04v.sys.comcast.net with ESMTP id ZzcLglFCm8iiqa6JHgYu21; Thu, 20 Dec 2018 21:56:51 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1545343011; bh=609cV1DR1ruBJdgWl434FC2mbwkif43Y0XL6e6SQ/gs=; h=Received:Received:Message-ID:From:To:Subject:Date:MIME-Version: Content-Type; b=QQcdhgpYTVqE9By8eHp0u0XW0OTrdLVviQqxEXOfhYKmx8mviggN9MJfTliHdQWc/ AjBzp5KTaRd0T7k9lHon+ZaySG3m+8u5EsrG8GzBfv7R3xheI2Z9vCFHYiks0sQB5F psBThrxOcw77zZFrr0n0/8ms2eCb0j1U2SAMmtY+6kFMhp2i69mH9E2b+nEsPROYd0 WB+kS6hKKMSwENyMMX5R9no89/96OD0H9tqMVCQ3tTdVKAhAvP1PSUOEEOvjjmPvpo fVjDmxTeXnPpfy+lqHR0xHLimIq+FhkP7A+0FatqYTMoVS8ha9x1tZtEKeHNO/zl7u OqCfMdQZc2Vhw== Received: from DELL4 ([73.4.253.141]) by resomta-ch2-04v.sys.comcast.net with ESMTPA id a6JFgHnJOwDmCa6JFgmhpm; Thu, 20 Dec 2018 21:56:51 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtkedrudejfedgudehiecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfenuceurghilhhouhhtmecufedttdenucenucfjughrpefkhffvfhfuffggtgfgrfgioffqsehtjeejtddutdejnecuhfhrohhmpeeojhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvtheqnecukfhppeejfedrgedrvdehfedrudegudenucfrrghrrghmpehhvghlohepfffgnffngedpihhnvghtpeejfedrgedrvdehfedrudeguddpmhgrihhlfhhrohhmpehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtpdhrtghpthhtoheprhhsghgspghlfhgpghhrohhuphessghlrggtkhhshhgvvghprdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-Xfinity-VMeta: sc=0;st=legit Message-ID: From: To: References: Date: Thu, 20 Dec 2018 16:56:49 -0500 MIME-Version: 1.0 X-Priority: 3 X-MSMail-Priority: Normal X-Mailer: Microsoft Outlook Express 6.00.2900.5512 X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2900.5512 X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Eric In the Spectrum Lab Components window (Components>Show Components) is the DAC showing green? If not, you may need to right click on it and enable it. Jay W1VD Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:36 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: 086f3faad0220c9ae57a7913e711a86d Subject: LF: Re: Spec Lab Transmit Content-Type: text/plain; format=flowed; charset="UTF-8"; reply-type=response Content-Transfer-Encoding: 7bit X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: * X-Spam-Status: No, hits=1.9 required=5.0 tests=FORGED_MUA_OUTLOOK, NO_REAL_NAME autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false Eric In the Spectrum Lab Components window (Components>Show Components) is the DAC showing green? If not, you may need to right click on it and enable it. Jay W1VD ----- Original Message ----- From: "Eric NO3M" To: "LF Group" Sent: Thursday, December 20, 2018 4:26 PM Subject: LF: Spec Lab Transmit > Is there some "trick" or setting to get Spec Lab to transmit audio? The digi settings were pulled > from the Predefined selections in all cases tested (QRSS, DFCW, BPSK31, etc) and nothing, > including the unmodulated test signal, will generate audio output. Soundcard selects should be > correct. Receive works fine. > > I am running Spec Lab under WINE in Linux, but see the same behavior in VirtualBox running Win7 > and another user reported similar behavior under what I believe was a real Windows machine. > > The RX spectrum window continues to scroll and show the actual current received spectrum. The > TX/RX button in the digi windows flashes. If the program was trying to output audio, when running > under WINE, I should see a conenction open up in the PulseAudio manger, but nothing. So it appears > Spec Lab is not even trying to open an audio output connection. > > Any info appreciated. > > 73 Eric NO3M > >