Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x0NIOT0B019239 for ; Wed, 23 Jan 2019 19:24:36 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gmN8n-0001yp-Im for rs_out_1@blacksheep.org; Wed, 23 Jan 2019 18:20:45 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gmN8i-0001yg-E3 for rsgb_lf_group@blacksheep.org; Wed, 23 Jan 2019 18:20:40 +0000 Received: from resqmta-ch2-01v.sys.comcast.net ([2001:558:fe21:29:69:252:207:33]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1gmN8g-0004wE-6L for rsgb_lf_group@blacksheep.org; Wed, 23 Jan 2019 18:20:39 +0000 Received: from resomta-ch2-02v.sys.comcast.net ([69.252.207.98]) by resqmta-ch2-01v.sys.comcast.net with ESMTP id mIergmB1iaPJWmN8bgj79J; Wed, 23 Jan 2019 18:20:33 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1548267633; bh=22jJQuwuXlSttI0VZXuyhJIGWIuPiKCDB53KbCMXMQM=; h=Received:Received:Message-ID:From:To:Subject:Date:MIME-Version: Content-Type; b=a7EtmTRyztG9drKiCkIDkl7pu8hOIg3OQ1/r+Z721jw4uoUVRLZLwJCgxuX97AUpy ucbQbbv7ooR3slpd1xJQJzlD1QesjWoo6dCsm138XtPzGwtxlOxEzprZv/SPP1nmO+ REn8LJpIKueScMrPeCTfKBGYGT8Hsx+7BGNYXIJnyHjftshEKLpD7KEgl2+Utdyoj0 rLUiCXSJRaQMPzEvzyUHk5URPno507gGQRXYNDK/b9bCCA1UXmQSxANr1POKwfeZCd n+QQZtV3rdnLRrC7SfM2rcqsN/go7bUmK2ORB+xAI26BuLY9qXgf1zXSB6elMjeHvG 6Ns9cJZetsApg== Received: from DELL4 ([73.4.253.141]) by resomta-ch2-02v.sys.comcast.net with ESMTPA id mN8YgDQmeVincmN8YgLUOS; Wed, 23 Jan 2019 18:20:33 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtledriedtgdduudefucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuvehomhgtrghsthdqtfgvshhipdfqfgfvpdfpqffurfetoffkrfenuceurghilhhouhhtmecufedttdenucenucfjughrpefkhffvfhfuffggtgfrigfoqfesrgdtjeepuddtjeenucfhrhhomhepoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucffohhmrghinheprggsvghlihgrnhdrohhrghenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopeffgffnnfegpdhinhgvthepjeefrdegrddvheefrddugedupdhmrghilhhfrhhomhepjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdprhgtphhtthhopehrshhgsggplhhfpghgrhhouhhpsegslhgrtghkshhhvggvphdrohhrghenucevlhhushhtvghrufhiiigvpedt X-Xfinity-VMeta: sc=0;st=legit Message-ID: From: To: References: <1541712573053.31739@kuleuven.be> <5C3F2E54.1080204@posteo.de> <5C44B472.9090901@posteo.de> <1UTCP1TTXz.GTBnkuWTAJs@optiplex980-pc> <1UTCP1tymN.HCrj4Hc5Ogz@optiplex980-pc> <8B74554DD9CC447AA7826347ACFA2369@DELL4> <1UTCRCaEyH.MEMhnQf8VB0@optiplex980-pc> <39F4B622-3145-438E-A048-FBABC6A174A1@md.metrocast.net> <5C4869F8.5060703@posteo.de> Date: Wed, 23 Jan 2019 13:20:30 -0500 MIME-Version: 1.0 X-Priority: 3 X-MSMail-Priority: Normal X-Mailer: Microsoft Outlook Express 6.00.2900.5512 X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2900.5512 X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Stefan Yes, I was aware of that. It probably would have been a good idea to have defined 'low Rank' ... last night there were a number of decodes well under 250 ... many just double digits. Can't recall that [...] Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:33 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: 88a66a3f0f748d37a45cddfb36a535ad Subject: Re: LF: EbNaut tonite Content-Type: multipart/alternative; boundary="----=_NextPart_000_034A_01D4B31E.6974A570" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: *** X-Spam-Status: No, hits=3.4 required=5.0 tests=FORGED_MUA_OUTLOOK,HTML_40_50, HTML_MESSAGE,MAILTO_TO_SPAM_ADDR,NO_REAL_NAME autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format. ------=_NextPart_000_034A_01D4B31E.6974A570 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Stefan Yes, I was aware of that. It probably would have been a good idea to = have defined 'low Rank' ... last night there were a number of decodes = well under 250 ... many just double digits. Can't recall that happening = in past sessions so thought it was noteworthy.=20 Jay W1VD ----- Original Message -----=20 From: DK7FC=20 To: rsgb_lf_group@blacksheep.org=20 Sent: Wednesday, January 23, 2019 8:19 AM Subject: Re: LF: EbNaut tonite Hi Rob, Jay,=20 You need to select a lower list length if CRC8 is used together with 8 = characters. See = http://abelian.org/ebnaut/calc.php?sndb=3D20&snbws=3D&snmps=3D1776&code=3D= 8K19&sp=3D3&crc=3D8&nc=3D8&submit=3DCalculate to calculate the optimum = list length. It is 280 for a full phase search. If you keep the default = 20000, then a number of false decodes are highly likely. 73, Stefan Am 23.01.2019 13:31, schrieb Rob Renoud:=20 Riccardo and Jay, No decodes here either. Had a number of low Rank false decodes = also. Suspect the low CRC may have allowed the false decodes. I had = similar results during the previous run. Suggest a shorter character message with a higher CRC with a similar = duration. Also, if possible, suggest transmitting the message on the = hour and running an unmodulated carrier during the idle period to enable = monitoring with ARGO or a similar app. I have found this very useful = tool with EbNaut transmissions from VO1NA and K3SIW on 2200m and = 185.185... kHz (LoFER) respectively. 73, Rob - K3RWR On Jan 23, 2019, at 06:17, "jrusgrove@comcast.net" = wrote: Riccardo Late start last night (0000z). Unfortunately no decodes. There = were numerous low Rank false decodes ... not sure what's up with that! Jay W1VD ----- Original Message ----- From: Riccardo Zoli Reply-To: To: LF Group Sent: 1/22/2019 2:48:00 PM Subject: Re: LF: EbNaut tonite ------------------------------------------------------------------------ Sorry: message repeated every 30 minutes. 73, Riccardo IW4DXW Il giorno Mar 22 Gen 2019, 20:15 Riccardo Zoli = ha scritto: Jay, Rob, LF QRG 137545 Hz Coding 8K19A CRC 8 3 sec./sym. 8 characters duration 29 min. 36 sec. no time delay (1st on 1930 UTC, last on 0700 UTC) Reports are welcome All the best 73 de Riccardo IW4DXW Il giorno Lun 21 Gen 2019, 23:03 ha = scritto: Riccardo Glad to hear you found the problem. Will await your = announcement and look for your signal tomorrow night. Jay W1VD ----- Original Message -----=20 From: Riccardo Zoli=20 To: LF Group=20 Sent: Monday, January 21, 2019 4:13 PM Subject: Re: LF: EbNaut tonite Jay, Rob, Markus, Stefan, Joe, LF Jay, thanks again for the decode: congrats for your rx = setup. And thank you so much for trying, Rob. Here, the TP2 reference signal (not sufficiently filtered) = overshot sometimes the quadrature divider (x4) causing that phase jumps. = The problem is now fixed. A new TX EbNaut session is scheduled for starting tomorrow = evening. All the best 73 de Riccardo IW4DXW Il giorno Lun 21 Gen 2019, 13:20 jrusgrove@comcast.net = ha scritto: Riccardo Corrected decode: 0300 Rank 0 car Eb/N0 2.3 Eb/N0 1.4 FBDECODE Jay W1VD ----- Original Message ----- From: Reply-To: To: Sent: 1/21/2019 6:53:39 AM Subject: Re: LF: EbNaut tonite -------------------------------------------------------------- Stefan, Riccardo & EbNaut-eers Stefan ... good copy throughout the night. Riccardo = ... unfortunately only one decode to report. Markus noted a frequency = error ... curious if propagation or NE0-M8T?=20 137545 2200 Rank 0 car Eb/N0 9.5 Eb/N0 9.2 RADIO GAGA 2300 - 0000 Rank 0 car Eb/N0 9.2 Eb/N0 9.3 RADIO GAGA 0100 Rank 0 car Eb/N0 6.0 Eb/N0 6.0 RADIO GAGA 0200 Rank 0 car Eb/N0 5.3 Eb/N0 5.9 RADIO GAGA 0300 Rank 0 car Eb/N0 6.1 Eb/N0 6.8 RADIO GAGA 0400 Rank 0 car Eb/N0 11.3 Eb/N0 10.4 RADIO GAGA 0500 Rank 0 car Eb/N0 3.7 Eb/N0 4.6 RADIO GAGA 0600 Rank 0 car Eb/N0 10.6 Eb/N0 10.2 RADIO GAGA 137547 0300 Rank 0 car Eb/N0 10.0 Eb/N0 FBDECODE Jay W1VD ----- Original Message ----- From: DK7FC Reply-To: To: Sent: 1/20/2019 12:48:34 PM Subject: LF: EbNaut tonite ------------------------------------------------------------ LF,=20 Tonite: f =3D 137.545 kHz Start time: 20.JAN.2019 22:00:00.3 UTC (hourly, = including 6 UTC) Symbol period: 1 s Characters: 10 CRC bits: 12 Coding 16K21A Antenna current: 4 A Duration: 24:32 [mm:ss] 73, Stefan ------=_NextPart_000_034A_01D4B31E.6974A570 Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable =EF=BB=BF
Stefan
 
Yes, I was aware of that. It = probably would=20 have been a good idea to have defined 'low Rank' ... last night = there were=20 a number of decodes well under 250 ... many just double = digits. Can't=20 recall that happening in past sessions so thought it was=20 noteworthy. 
 
Jay W1VD
----- Original Message -----
From:=20 DK7FC=20
Sent: Wednesday, January 23, = 2019 8:19=20 AM
Subject: Re: LF: EbNaut = tonite

Hi Rob, Jay,

You need to select a lower list = length if=20 CRC8 is used together with 8 characters.
See http://abelian.org/ebnaut/calc.php?sndb=3D20&snbws=3D&= snmps=3D1776&code=3D8K19&sp=3D3&crc=3D8&nc=3D8&submit= =3DCalculate=20 to calculate the optimum list length. It is 280 for a full phase = search. If=20 you keep the default 20000, then a number of false decodes are highly=20 likely.

73, Stefan

Am 23.01.2019 13:31, schrieb Rob = Renoud:=20
Riccardo and Jay,

No decodes here either.  Had a number of low = Rank false=20 decodes also.  Suspect the low CRC  may have allowed the = false=20 decodes.  I had similar results during the previous run.

Suggest a shorter character message with a higher CRC = with a=20 similar duration.  Also, if possible,  suggest = transmitting the=20 message on the hour and running an unmodulated carrier during the = idle=20 period to enable monitoring with ARGO or a similar app.  I have = found=20 this very useful tool with EbNaut transmissions from VO1NA and K3SIW = on=20 2200m and 185.185... kHz (LoFER) respectively.

73,
Rob - K3RWR

On Jan 23, 2019, at 06:17, "jrusgrove@comcast.net" <jrusgrove@comcast.net> = wrote:

Riccardo
 
Late start last night (0000z). Unfortunately no decodes. = There were=20 numerous low Rank false decodes ... not sure what's up with = that!
 
Jay W1VD
 
 
----- Original Message -----
From: Riccardo Zoli <riccardozoli80@gmail.com>
To: LF Group <rsgb_lf_group@blacksheep.org>
Sent: 1/22/2019 2:48:00 PM
Subject: Re: LF: EbNaut tonite

Sorry: message repeated every 30 minutes.

73, Riccardo IW4DXW

Il giorno Mar 22 Gen 2019, 20:15 Riccardo Zoli = <riccardozoli80@gmail.com> ha=20 scritto:

Jay, Rob, LF

QRG 137545 Hz
Coding 8K19A
CRC 8
3 sec./sym.
8 characters
duration 29 min. 36 sec.
no time delay
(1st on 1930 UTC, last on 0700 UTC)

Reports are welcome


All the best

73 de Riccardo IW4DXW



Il giorno Lun 21 Gen 2019, 23:03 <jrusgrove@comcast.net> ha=20 scritto:
Riccardo
 
Glad to hear you found the = problem.=20 Will await your announcement and look for your signal = tomorrow=20 night.
 
Jay W1VD
-----=20 Original Message -----
From:=20 Riccardo Zoli
To:=20 LF=20 Group
Sent:=20 Monday, January 21, 2019 4:13 PM
Subject:=20 Re: LF: EbNaut tonite


Jay, Rob, Markus, Stefan, Joe, LF


Jay, thanks again for the decode: congrats for your = rx=20 setup.
And thank you so much for trying, Rob.

Here, the TP2 reference signal (not sufficiently = filtered)=20 overshot sometimes the quadrature divider (x4) causing = that phase=20 jumps. The problem is now fixed.

A new TX EbNaut session is scheduled for starting = tomorrow=20 evening.

All the best


73 de Riccardo IW4DXW







Il giorno Lun 21 Gen 2019, 13:20 jrusgrove@comcast.net <jrusgrove@comcast.net> ha=20 scritto:
Riccardo
 
Corrected decode:
 
0300 Rank 0 car Eb/N0 2.3=20 Eb/N0 1.4 FBDECODE
 
Jay W1VD
 
 
 
----- Original Message -----
Reply-To: <rsgb_lf_group@blacksheep.org>
To: <rsgb_lf_group@blacksheep.org>
Sent: 1/21/2019 6:53:39 AM
Subject: Re: LF: EbNaut tonite
Stefan, Riccardo & EbNaut-eers
 
 
Stefan ... good copy throughout the night. = Riccardo ...=20 unfortunately only one decode to report. Markus = noted a=20 frequency error ... curious if propagation=20 or NE0-M8T?
 
 
137545
 
2200 Rank 0 car Eb/N0 9.5 Eb/N0 9.2 RADIO = GAGA
2300 -
0000 Rank 0 car Eb/N0 9.2 Eb/N0 9.3 RADIO = GAGA
0100 Rank 0 car Eb/N0 6.0 Eb/N0 6.0 = RADIO=20 GAGA
0200 Rank 0 car Eb/N0 5.3 Eb/N0 5.9 = RADIO=20 GAGA
0300 Rank 0 car Eb/N0 6.1 Eb/N0 6.8 = RADIO=20 GAGA
0400 Rank 0 car Eb/N0 11.3 Eb/N0 10.4 = RADIO=20 GAGA
0500 Rank 0 car Eb/N0 3.7 Eb/N0 4.6 = RADIO=20 GAGA
0600 Rank 0 car Eb/N0 10.6 Eb/N0 10.2 = RADIO=20 GAGA
 
 
137547
 
0300 Rank 0 car Eb/N0 10.0=20 Eb/N0  FBDECODE
 
Jay W1VD
 
 
 
 
 
 
----- Original Message -----
From: DK7FC <selberdenken@posteo.de>
Reply-To: <rsgb_lf_group@blacksheep.org>
To: <rsgb_lf_group@blacksheep.org>
Sent: 1/20/2019 12:48:34 PM
Subject: LF: EbNaut tonite
LF,

Tonite:

f =3D 137.545 = kHz
Start time:=20 20.JAN.2019  22:00:00.3 UTC (hourly, including = 6=20 UTC)
Symbol period: 1 s
Characters: 10
CRC=20 bits: 12
Coding 16K21A
Antenna = current: 4=20 A
Duration: 24:32 [mm:ss]


73,=20 = Stefan
------=_NextPart_000_034A_01D4B31E.6974A570--