Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x42EBD6N007434 for ; Thu, 2 May 2019 16:11:14 +0200 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1hMCJ9-0004OM-RM for rs_out_1@blacksheep.org; Thu, 02 May 2019 15:03:31 +0100 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1hMCH8-0004OD-Lp for rsgb_lf_group@blacksheep.org; Thu, 02 May 2019 15:01:27 +0100 Received: from resqmta-ch2-10v.sys.comcast.net ([2001:558:fe21:29:69:252:207:42]) by relay1.thorcom.net with esmtps (TLSv1.2:DHE-RSA-AES256-GCM-SHA384:256) (Exim 4.92) (envelope-from ) id 1hMCGy-00056W-1V for rsgb_lf_group@blacksheep.org; Thu, 02 May 2019 15:01:20 +0100 Received: from resomta-ch2-03v.sys.comcast.net ([69.252.207.99]) by resqmta-ch2-10v.sys.comcast.net with ESMTP id MBzjhSGJ6CjHTMCGth2re8; Thu, 02 May 2019 14:01:11 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=20190202a; t=1556805671; bh=Ul2aMbjGUhiKs9tRllEsZM4VQBXC/Fqm9dGXzT7H1AA=; h=Received:Received:Message-ID:From:To:Subject:Date:MIME-Version: Content-Type; b=a0rOCJDNJBxsiaiv+xpMUQFsZp7eOf9sA+Lxgko1v++c3ZFakn8D74xa7rXCS3IzI gsrXEkfEURQOSIb0fKbPjrpT2iQQ633Qh/y8Zi14eofx9bo9BrtQ8eyopuehdrEbzW l4G/mbGumUpT36MXb5C83NjHvcaDUIalgetKZnIdavFA1TUAyZz2co5SPvva+6wR7s ZsImsgzeClYsZay3PKo+UERrBv8OaHbu+NlNJB2icUtsciTvzVcj5GBtrv9fD016Bi IzWwP08bY5zZJZRRKTEbwyeObFUVTrtZ2xdMMnCn+uwxn3rS2Jw9PN4O0xB+sLexCl B1xxteYGYczMQ== Received: from DELL4 ([73.4.253.141]) by resomta-ch2-03v.sys.comcast.net with ESMTPA id MCGshdMjVLq86MCGthVDE8; Thu, 02 May 2019 14:01:11 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgeduuddrieelgdejgecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddtnecunecujfgurhepkffhvfhfufffgggtgffrigfoqfesthejjedtuddtudenucfhrhhomhepoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopeffgffnnfegpdhinhgvthepjeefrdegrddvheefrddugedupdhmrghilhhfrhhomhepjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdprhgtphhtthhopehrshhgsggplhhfpghgrhhouhhpsegslhgrtghkshhhvggvphdrohhrghenucevlhhushhtvghrufhiiigvpedt X-Xfinity-VMeta: sc=0;st=legit Message-ID: From: To: References: <1019495001.20190502130019@gmail.com> Date: Thu, 2 May 2019 10:01:09 -0400 MIME-Version: 1.0 X-Priority: 3 X-MSMail-Priority: Normal X-Mailer: Microsoft Outlook Express 6.00.2900.5512 X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2900.5512 X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Chris None in stock but would be happy to get them for you. Only possible problem is the customs forms ... I'm required to list the values of items accurately. I had a run in with US Customs years ago and d [...] Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:42 listed in] [list.dnswl.org] 0.2 STOX_REPLY_TYPE No description available. -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) -0.1 DKIM_VALID_EF Message has a valid DKIM or DK signature from envelope-from domain -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily valid -0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from author's domain X-Scan-Signature: 66d07794ca19cd68f7d6cc289cd4ac18 Subject: LF: Re: Toroids Content-Type: text/plain; format=flowed; charset="iso-8859-1"; reply-type=original Content-Transfer-Encoding: 7bit X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: * X-Spam-Status: No, hits=1.9 required=5.0 tests=FORGED_MUA_OUTLOOK, NO_REAL_NAME autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false Chris None in stock but would be happy to get them for you. Only possible problem is the customs forms ... I'm required to list the values of items accurately. I had a run in with US Customs years ago and don't wish to take a chance getting tangled up with them again. Let me know and I'll check pricing for the cores and shipping. A pi-type filter is what's required for current mode. The amplifier as shown in the schematic 'appears' to be current mode since there's no bypass at the centertap of the transformer. Not sure why you're seeing hot components. In the schematic it appears the ground was left off the bottom of LPF capacitors ... I'm sure you picked up on this. Don't think I'd use a -26 core at 500 kHz ... this may or may not be the problem. Jay W1VD ----- Original Message ----- From: "Chris Wilson" To: Sent: Thursday, May 02, 2019 8:00 AM Subject: Toroids > > > Hello Jay, > > I am going to build the MF version of your 1kW amp deck to compliment > the LF versions that have proven superb! I am struggling getting the > T-225A-2 toroids and the T-157-3 ones here in the UK without Amidon > trying to charge far more than the cost in postage, plus a hefty > import duty / tax. Would you consider supplying these direct and > marking the package note as a low value (at my risk)? I could do with > three of T-225A-2 and 4 of the T-157-3 toroids. Here in the UK no one > has any stock of either. If it's a PITA and you are unable to oblige > or you don't have them, no worries :) Thanks. Chris Wilson 2E0ILY. > > BTW, off list, I built the G0MRF MF 300W amp and at full power it runs > the toroids and C19 C20 mad hot, plus the drain waveforms look > horrible. Am I right in thinking he's using a current mode LPF on a > voltage mode amp? And are the components like caps and toroids > marginal at this power level? I am sure your MF amp is much more > robust :) > > -- > Best regards, > Chris mailto:dead.fets@gmail.com