Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x0HF3Nw4010206 for ; Thu, 17 Jan 2019 16:03:34 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gk963-0006ZY-Bc for rs_out_1@blacksheep.org; Thu, 17 Jan 2019 14:56:43 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gk961-0006ZP-H9 for rsgb_lf_group@blacksheep.org; Thu, 17 Jan 2019 14:56:41 +0000 Received: from resqmta-ch2-11v.sys.comcast.net ([2001:558:fe21:29:69:252:207:43]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1gk95y-0006Zy-KY for rsgb_lf_group@blacksheep.org; Thu, 17 Jan 2019 14:56:40 +0000 Received: from resomta-ch2-17v.sys.comcast.net ([69.252.207.113]) by resqmta-ch2-11v.sys.comcast.net with ESMTP id k8RYggDQ2MwIMk95ugGd6O; Thu, 17 Jan 2019 14:56:34 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1547736994; bh=IoB8uEKoI+s/FB9FD4bGKmXazr911Zvd3CIjvt1i0eg=; h=Received:Received:Message-ID:From:To:Subject:Date:MIME-Version: Content-Type; b=Pk39ZId9H6/Iaf8nb0wrmR7P462K97wXpFlE9iB2zzrgEMDk2aJXjL1EKNo+VtriD Ca8gLRADKVKmSaWu07NVtmTFhXxkf1ZMp+TaIqzdvOs1yAQR3PiLSThEOoljw06bZH FoZJkC3K/f033o3mgUttKzAb+ovddiOamzRUh8/jsshos56qjNRbDWj5egJhsF+0TS u9fj2FIPK/NwSEY6Sd5nOj/Qbeh2XpE6lZQTTWP7XnayvpbTuKqTXjpxwYKGGF1BF9 ccavZpXwcqnfgPlmkTwn1kSunI5TpLjSrdhEYCpy3d/M4LomZbfGyNCGj589F/bu9U KJn7ZJC4uSzJg== Received: from DELL4 ([73.4.253.141]) by resomta-ch2-17v.sys.comcast.net with ESMTPA id k95sg7UaMDNxVk95sgjfas; Thu, 17 Jan 2019 14:56:34 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtledrgeekgdeigecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddtnecunecujfgurhepkffhvfhfufffgggtgffrigfoqfesthejjedtuddtjeenucfhrhhomhepoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopeffgffnnfegpdhinhgvthepjeefrdegrddvheefrddugedupdhmrghilhhfrhhomhepjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdprhgtphhtthhopehrshhgsggplhhfpghgrhhouhhpsegslhgrtghkshhhvggvphdrohhrghenucevlhhushhtvghrufhiiigvpedt X-Xfinity-VMeta: sc=0;st=legit Message-ID: From: To: References: <16856e12994.marcocadeddu@tin.it> <92fbbb62-a1fe-0e0f-c048-08dd3c2cdfb2@n1bug.com> <1973353494.20190117121430@gmail.com> Date: Thu, 17 Jan 2019 09:56:31 -0500 MIME-Version: 1.0 X-Priority: 3 X-MSMail-Priority: Normal X-Mailer: Microsoft Outlook Express 6.00.2900.5512 X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2900.5512 X-Spam-Score: -0.5 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Just double nut on each side of the plastic ... Jay W1VD ----- Original Message ----- From: "N1BUG" To: Sent: Thursday, January 17, 2019 7:34 AM Subject: Re: R: RE: LF: JT9-10 vs JT9-5 test ends with smoke :) Content analysis details: (-0.5 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:43 listed in] [list.dnswl.org] 0.2 STOX_REPLY_TYPE No description available. -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: b1e5ebccbad86c8ca1fd46d24f0285de Subject: Re: R: RE: LF: JT9-10 vs JT9-5 test ends with smoke :) Content-Type: text/plain; format=flowed; charset="utf-8"; reply-type=original Content-Transfer-Encoding: 7bit X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: * X-Spam-Status: No, hits=1.9 required=5.0 tests=FORGED_MUA_OUTLOOK, NO_REAL_NAME autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false Just double nut on each side of the plastic ... Jay W1VD ----- Original Message ----- From: "N1BUG" To: Sent: Thursday, January 17, 2019 7:34 AM Subject: Re: R: RE: LF: JT9-10 vs JT9-5 test ends with smoke :) > Hi Chris, > > That is an interesting idea. I think it should be a press fit to so > it doesn't tilt to the side and cause the coil winding to be a bit > loose. > > I was thinking along another line. Use a machine screw through the > coil form as before (make it brass this time), but instead of > attaching the inside were lug under the screw head, bring the wire > out through a hole near the machine screw, bend it over and put a > lug on it outside. Then this lug and the one from the end of the > coil itself can be pressed against each other between two nuts (or > nut, lug, lug, lock washer, nut). The would assure better contact > and should reduce the tendency for the most critical part of the > assembly to loosen. If one were to be very paranoid, he could even > solder a short safety jumper from lug to lug. ;-) > > 73, > Paul > > > On 1/17/19 7:14 AM, Chris Wilson wrote: >> >> >> Hello N1BUG, >> >> Personally I would machine or cut a piece of brass tube so the bolt >> head, nut and washers, plus the connectors are tightened against the >> brass tube, not the plastic. The tube can then just be a loose or push >> fit into the plastic former. >> >> Thursday, January 17, 2019, 12:01:19 PM, you wrote: >> >>> Hi Marco, >> >>> It's always interesting to see pics from other collections if you >>> want to share. :-) >> >>> After careful study of the ruined coil, I made a guess: >> >>> SS hardware was a poor choice. Using the machine screw to carry RF >>> from inside to outside of the coil form was not the best way. I >>> think the hardware became slightly loose. We have all seen this >>> happen when hardware is installed in "soft" plastics. Loose hardware >>> caused higher resistance in the connection and more heat. More heat >>> softened the plastic, which made the hardware more loose, more >>> resistance, more heat. Eventually the connection became so loose >>> there was an arc, too much heat and everything burned. >> >>> Well, it's just a guess, but it's not too hard to imagine this can >>> happen. >> >>> Every nut and screw on that unit was a bit loose, even the ones that >>> did not yet show any sign of overheating. >> >>> I cut and drilled already a new coil form but I wait now for brass >>> hardware to arrive before winding. >> >>> 73, >>> Paul >