Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x0SJnRGn018320 for ; Mon, 28 Jan 2019 20:49:35 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1goCjZ-0006RM-6C for rs_out_1@blacksheep.org; Mon, 28 Jan 2019 19:38:17 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1goCjG-0006RD-Hu for rsgb_lf_group@blacksheep.org; Mon, 28 Jan 2019 19:37:58 +0000 Received: from resqmta-ch2-01v.sys.comcast.net ([2001:558:fe21:29:69:252:207:33]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1goCjD-0005Fv-Vw for rsgb_lf_group@blacksheep.org; Mon, 28 Jan 2019 19:37:57 +0000 Received: from resomta-ch2-01v.sys.comcast.net ([69.252.207.97]) by resqmta-ch2-01v.sys.comcast.net with ESMTP id o7fQgrrJSaPJWoCj9guuNr; Mon, 28 Jan 2019 19:37:51 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1548704271; bh=JT4wfqeNLrSSGYuKZEWumFGCtNaSwSK6vm1byLivUro=; h=Received:Received:Message-ID:From:To:Subject:Date:MIME-Version: Content-Type; b=XhYYkxg5m+/zblh0M1v9xHraboYDGGZOoNg/UGsfcu5qmPWunWxy/Hh+g0n+BeG1Z gBCy9OGuYkOgvK75Ojr+/fQZStSBhJqNnJv4tuslq0Dh1uRfRnSCAVj7tPCNmsY7lr fGGoHBEG574EzL3AY2pxSWaoguPQZNG3JrOxE77if/tnX9GBVT3FNS+mvbXs3Sg1ZG zO8U8q0k3ANyJkN9ruk70ctD9CXQZejREBXmKVFhjYS2eBJEe85NH5IL6yhltNINKh /mALdkAx9H5GOhvZin1HJaOnhRLzXP7fUhPCO1BghkOPIQrYS3VeFA8r3n/eYaqyDE tLU/xf3dZ1CyQ== Received: from DELL4 ([73.4.253.141]) by resomta-ch2-01v.sys.comcast.net with ESMTPA id oCj6g6nULXnyHoCj7gWzz7; Mon, 28 Jan 2019 19:37:51 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtledrjedtgddufeduucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuvehomhgtrghsthdqtfgvshhipdfqfgfvpdfpqffurfetoffkrfenuceurghilhhouhhtmecufedttdenucenucfjughrpefkhffvfhfuffggtgfrigfoqfesrgdtjeepuddtjeenucfhrhhomhepoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopeffgffnnfegpdhinhgvthepjeefrdegrddvheefrddugedupdhmrghilhhfrhhomhepjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdprhgtphhtthhopehrshhgsggplhhfpghgrhhouhhpsegslhgrtghkshhhvggvphdrohhrghenucevlhhushhtvghrufhiiigvpedt X-Xfinity-VMeta: sc=0;st=legit Message-ID: <9B71DE4D028A40818CACBB3955CFE65E@DELL4> From: To: References: <1690723859.1653766.1548539148821.ref@mail.yahoo.com> <1690723859.1653766.1548539148821@mail.yahoo.com> <1UTCWet7ZZ.BO7EfIhLRDp@optiplex980-pc> Date: Mon, 28 Jan 2019 14:37:48 -0500 MIME-Version: 1.0 X-Priority: 3 X-MSMail-Priority: Normal X-Mailer: Microsoft Outlook Express 6.00.2900.5512 X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2900.5512 X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: Riccardo What was your transmission schedule last night ... I must have missed it. Jay W1VD Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:33 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message X-Scan-Signature: a3a1dfa33e290fbc5bf9437ae2cb4207 Subject: Re: LF: Ebnaut tonite from JN80 Content-Type: multipart/alternative; boundary="----=_NextPart_000_0159_01D4B717.0A629270" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: *** X-Spam-Status: No, hits=3.4 required=5.0 tests=FORGED_MUA_OUTLOOK,HTML_40_50, HTML_MESSAGE,MAILTO_TO_SPAM_ADDR,NO_REAL_NAME autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format. ------=_NextPart_000_0159_01D4B717.0A629270 Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable Riccardo What was your transmission schedule last night ... I must have missed = it. Jay W1VD ----- Original Message -----=20 From: Riccardo Zoli=20 To: LF Group=20 Sent: Monday, January 28, 2019 1:22 PM Subject: Re: LF: Ebnaut tonite from JN80 Rob, Jay, thank you so much, as always, for reports. Rob: QRB is 7048 km, congratulations! It's a really excellent job. All the best 73 de Riccardo IW4DXW Il giorno Lun 28 Gen 2019, 13:20 Rob Renoud = ha scritto: Domenico and Riccardo, Riccardo: 1 Decode at 2300 UTC Rank 0; cEb/N0 3.2; Eb/N0 0.9; MSG 73, BER 38.7; Ref Phase 0,0,0,0 Domenico: Sorry, no decodes. 73, Rob On Jan 28, 2019, at 06:06, "jrusgrove@comcast.net" = wrote: Domenico Sorry to report no decodes ;~( . Jay W1VD ----- Original Message ----- From: Domenico IZ7SLZ Reply-To: To: Sent: 1/27/2019 1:32:37 PM Subject: Re: LF: Ebnaut tonite from JN80 ------------------------------------------------------------------------ Rob, Jay, LF=20 Another attempt tonight. Same parameters (6 char, 3 s/sym, = crc16, 8K19A) Qrq is 137545.2 Hz=20 (The script is ok now!!) Every hour from 21.00 utc 'til 07 utc of tomortow) 73, Domenico IZ7SLZ=20 On 27 Jan 2019 15:25, "Rob Renoud" = wrote: Domenico, No decodes as you were outside of my receive range. 73, Rob On Jan 27, 2019, at 05:27, Domenico IZ7SLZ = wrote: LF, my previous transmission's announcement was wrong. Since i have run an obsolete setup file, the transmissions = succeeded but on 137540.0 Hz (instead of 137545.2 Hz) with 6 char, 3 s, 8K19A, CRC16. I hope that receiving attempts can be done anyway. Sorry for = the trouble. I will send now, via daytime propagation, an 'hope' message = on 137540 Hz, 38 characters 0.5 s/sym 8K19A, CRC16 at 10:30, 11:30, 12:30, 13:30. Finger crossed also for that situation ! 73, Domenico IZ7SLZ On Sun, 27 Jan 2019 at 00:24, Domenico IZ7SLZ = wrote: Yes Markus, LF=20 Confirm: 6 characters. Apologies for the clerical error and thanks Markus for the = advice. 73, Dom IZ7SLZ On Sat, 26 Jan 2019, 22:49 Markus Vester = An: rsgb_lf_group Verschickt: Sa, 26. Jan. 2019 19:55 Betreff: LF: Ebnaut tonite from JN80 LF, Ebnauteers=20 An attempt to pass my complete call sign with EbNaut on = 137545.2 Hz. 5 char, 3 s, 8K19A, CRC16, duration 28', every hour from = 21.00 UT to 08.00 UT of tomorrow. 73, Domenico IZ7SLZ ------=_NextPart_000_0159_01D4B717.0A629270 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable =EF=BB=BF
Riccardo
 
What was your transmission schedule = last night ...=20 I must have missed it.
 
Jay W1VD
 
----- Original Message -----
From:=20 Riccardo Zoli
Sent: Monday, January 28, 2019 = 1:22=20 PM
Subject: Re: LF: Ebnaut tonite = from=20 JN80


Rob, Jay,

thank you so much, as always, for reports.
Rob: QRB is 7048 km, congratulations! It's a really = excellent=20 job.

All the best

73 de Riccardo IW4DXW






Il giorno Lun 28 Gen 2019, 13:20 Rob Renoud <k3rwr@md.metrocast.net> ha scritto:
Domenico and Riccardo,

Riccardo:  1 Decode at 2300 UTC
Rank 0; cEb/N0 3.2; Eb/N0 0.9; MSG 73, BER 38.7; Ref = Phase=20 0,0,0,0

Domenico:  Sorry, no decodes.

73,
Rob

On Jan 28, 2019, at 06:06, "jrusgrove@comcast.net" <jrusgrove@comcast.net>=20 wrote:

Domenico
 
Sorry to report no decodes ;~( .
 
Jay W1VD
 
 
----- Original Message -----
From: Domenico IZ7SLZ <iz7slz.domenico@gmail.com>
Sent: 1/27/2019 1:32:37 PM
Subject: Re: LF: Ebnaut tonite from JN80
Rob, Jay, LF=20

Another attempt tonight. Same parameters (6 char, 3 s/sym, = crc16,=20 8K19A)
Qrq is 137545.2 Hz 
(The script is ok now!!)
Every hour from 21.00 utc 'til 07 utc of tomortow)

73, Domenico IZ7SLZ 

On 27 Jan 2019 15:25, "Rob Renoud" = <k3rwr@md.metrocast.net> = wrote:
Domenico,

No decodes as you were outside of my receive = range.

73,
Rob

On Jan 27, 2019, at 05:27, Domenico IZ7SLZ = <iz7slz.domenico@gmail.com>=20 wrote:

LF,
my previous  transmission's announcement was = wrong.

Since i have run an obsolete setup file, the = transmissions=20 succeeded but on 137540.0 Hz  (instead of 137545.2 Hz) = with=20 6
char, 3 s, 8K19A, CRC16.
I hope that receiving = attempts=20 can be done anyway. Sorry for the trouble.

I will send now, via daytime propagation, an 'hope' = message on=20 137540 Hz, 38 characters 0.5 s/sym 8K19A, CRC16
at 10:30, 11:30, 12:30, 13:30.

Finger crossed also for that situation !

73, Domenico IZ7SLZ







On Sun, 27 Jan 2019 at 00:24, Domenico IZ7SLZ = <iz7slz.domenico@gmail.com>=20 wrote:
Yes Markus, LF=20

Confirm: 6 characters.

Apologies for the clerical error and thanks Markus = for the=20 advice.

73, Dom IZ7SLZ

On Sat, 26 Jan 2019, 22:49 Markus Vester = <markusvester@aol.com=20 wrote:
Hi=20 Domenico,

6 characters I would guess?

73, = Markus


-----Urspr=C3=BCngliche = Mitteilung-----
Von:=20 Domenico IZ7SLZ <iz7slz.domenico@gmail.com>
An:=20 rsgb_lf_group <rsgb_lf_group@blacksheep.org>
Verschickt:=20 Sa, 26. Jan. 2019 19:55
Betreff: LF: Ebnaut tonite = from=20 JN80

LF, Ebnauteers=20

An attempt to pass my complete call sign with = EbNaut on=20 137545.2 Hz.

5 char, 3 s, 8K19A, CRC16, duration 28', every hour = from=20 21.00 UT to 08.00 UT of tomorrow.
73, Domenico=20 = IZ7SLZ

------=_NextPart_000_0159_01D4B717.0A629270--