Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x2IIldPh027804 for ; Mon, 18 Mar 2019 19:47:47 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1h5xE9-0001zn-EL for rs_out_1@blacksheep.org; Mon, 18 Mar 2019 18:43:13 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1h5xE8-0001ze-8a for rsgb_lf_group@blacksheep.org; Mon, 18 Mar 2019 18:43:12 +0000 Received: from resqmta-ch2-08v.sys.comcast.net ([2001:558:fe21:29:69:252:207:40]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1h5xE6-00021i-8p for rsgb_lf_group@blacksheep.org; Mon, 18 Mar 2019 18:43:11 +0000 Received: from resomta-ch2-03v.sys.comcast.net ([69.252.207.99]) by resqmta-ch2-08v.sys.comcast.net with ESMTP id 5xB7h67ZaXXFp5xDzhl2U3; Mon, 18 Mar 2019 18:43:03 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1552934583; bh=jl8w1ahtmd8flcYCBl5lRqP+YTjv1no1MloA6CNoyus=; h=Received:Received:Message-ID:From:To:Subject:Date:MIME-Version: Content-Type; b=V9cBXDXrxPVssQMhR6e1aPmPZD3GAV17ghCFqN8DC7lWO6oxifjDnRMrcwLlcGdRl DsIC/hBL268+jNYSugLIF/L0sJUWNcjztV7r14BiSvyH+UCttsqMl9MXBNPivW1l8l vQflFVhvs4/dx3wuPXj4veq+fFNN1oT6YoRKzByQ3EJurZ8sdVQ05KRTJgUqp6D+pD q/59m61EbPIT9tcaLjt9je3z55UpOyApaYzCEE9+4k4NQiecOhml5mtA5X81LO8ATl c/mJcZnHmXsIhNWwhbYnskZ47ejE1rlByYf2Jf8MN1mct2TRuKQeDkuUTZlPXQDxD/ IGvEjGoEmWwiA== Received: from DELL4 ([73.4.253.141]) by resomta-ch2-03v.sys.comcast.net with ESMTPA id 5xDxh8mwcTExL5xDxhfN7o; Mon, 18 Mar 2019 18:43:03 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedutddriedugdduudejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuvehomhgtrghsthdqtfgvshhipdfqfgfvpdfpqffurfetoffkrfenuceurghilhhouhhtmecufedttdenucenucfjughrpefkhffvfhfuffggtgfrigfoqfesrgdtjeepuddtleenucfhrhhomhepoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopeffgffnnfegpdhinhgvthepjeefrdegrddvheefrddugedupdhmrghilhhfrhhomhepjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdprhgtphhtthhopehrshhgsggplhhfpghgrhhouhhpsegslhgrtghkshhhvggvphdrohhrghenucevlhhushhtvghrufhiiigvpedt X-Xfinity-VMeta: sc=0;st=legit Message-ID: <8FE2CA27155743299E8540C3B2E1D07C@DELL4> From: To: References: <5C8FE37E.4000706@posteo.de> Date: Mon, 18 Mar 2019 14:43:01 -0400 MIME-Version: 1.0 X-Priority: 3 X-MSMail-Priority: Normal X-Mailer: Microsoft Outlook Express 6.00.2900.5512 X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2900.5512 X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: Stefan Tnx heads up ... will be looking for your EbNaut signal. Jay W1VD ----- Original Message ----- From: DK7FC To: Monday, March 18, 2019 2:29 PM Subject: LF: EbNaut tonite Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:40 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message X-Scan-Signature: 4f449c45f7b1894a9195a328eedaeb30 Subject: LF: Re: EbNaut tonite Content-Type: multipart/alternative; boundary="----=_NextPart_000_019A_01D4DD98.E2CF7040" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: ** X-Spam-Status: No, hits=2.1 required=5.0 tests=FORGED_MUA_OUTLOOK,HTML_50_60, HTML_MESSAGE,NO_REAL_NAME autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format. ------=_NextPart_000_019A_01D4DD98.E2CF7040 Content-Type: text/plain; charset="iso-8859-15" Content-Transfer-Encoding: quoted-printable Stefan Tnx heads up ... will be looking for your EbNaut signal. Jay W1VD ----- Original Message -----=20 From: DK7FC=20 To: rsgb_lf_group@blacksheep.org=20 Sent: Monday, March 18, 2019 2:29 PM Subject: LF: EbNaut tonite LF,=20 Time to TX on 137 again: Tonite: f =3D 137.545 kHz Start time: 18.MAR.2019 21:00:00.3 UTC (hourly, including 5 UTC) Symbol period: 1 s Characters: 29 CRC bits: 12 Coding 8K19A Antenna current: 4 A Duration: 27:12 [mm:ss] Reports welcome :-) 73, Stefan ------=_NextPart_000_019A_01D4DD98.E2CF7040 Content-Type: text/html; charset="iso-8859-15" Content-Transfer-Encoding: quoted-printable
Stefan
 
Tnx heads up ... will be looking for = your EbNaut=20 signal.
 
Jay W1VD
----- Original Message -----
From:=20 DK7FC=20
Sent: Monday, March 18, 2019 = 2:29=20 PM
Subject: LF: EbNaut = tonite

LF,

Time to TX on 137 = again:
Tonite:

f =3D=20 137.545 kHz
Start time: 18.MAR.2019  21:00:00.3 UTC (hourly, = including=20 5 UTC)
Symbol period: 1 s
Characters: 29
CRC bits:=20 12
Coding 8K19A
Antenna current: 4 A
Duration: 27:12=20 [mm:ss]

Reports welcome :-)

73,=20 Stefan

 ------=_NextPart_000_019A_01D4DD98.E2CF7040--