Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x0LM59w5007422 for ; Mon, 21 Jan 2019 23:05:16 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1glhap-0002a6-5c for rs_out_1@blacksheep.org; Mon, 21 Jan 2019 21:58:55 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1glhYb-0002Zt-3x for rsgb_lf_group@blacksheep.org; Mon, 21 Jan 2019 21:56:37 +0000 Received: from resqmta-ch2-01v.sys.comcast.net ([2001:558:fe21:29:69:252:207:33]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1glhYT-0000JU-6E for rsgb_lf_group@blacksheep.org; Mon, 21 Jan 2019 21:56:31 +0000 Received: from resomta-ch2-13v.sys.comcast.net ([69.252.207.109]) by resqmta-ch2-01v.sys.comcast.net with ESMTP id lZrggjdKdaPJWlhYOgeGGS; Mon, 21 Jan 2019 21:56:24 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1548107784; bh=Ik7xvZ0V4ySShDXVx1eKHYSsxYIk7G7sDNCAo4yO6MI=; h=Received:Received:Message-ID:From:To:Subject:Date:MIME-Version: Content-Type; b=bi+rvoT+2/0JOSBWwkEjhOMw5H0vcbvV2YYedNdmEbNGWfBm2PiLrnzZrFmtIxeUp SZ5CM1p/CvZKx3g9eaT246s+yy2SWkhgyVLnM8Rd64NJKOByvZTtw53xo3a6PBXFvS wfE84sPAB7OxnIqNq6I6cGo9nMSQlSzGJTBwsyG1pTMTbNYcTxt5gl5XsljfZS9iMT 5PcVb4e1p2GS44YAxnBgVdlSVebl5E/C7MyZj0yu8NnAYYQXeEI0U3+bu34ezRsoCm yMVCPOw2E3iet8Rm5C2NbaqOCECVvpEgLbPylkQiBkpTwlJ0ORfjLbqY0WY8xaCVrS QQSwRgWLE4fMw== Received: from DELL4 ([73.4.253.141]) by resomta-ch2-13v.sys.comcast.net with ESMTPA id lhYMguBlymgZAlhYNge8bD; Mon, 21 Jan 2019 21:56:24 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtledrheeigdduheejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuvehomhgtrghsthdqtfgvshhipdfqfgfvpdfpqffurfetoffkrfenuceurghilhhouhhtmecufedttdenucenucfjughrpefkhffvfhfuffggtgfrigfoqfesrgdtjeepuddtjeenucfhrhhomhepoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopeffgffnnfegpdhinhgvthepjeefrdegrddvheefrddugedupdhmrghilhhfrhhomhepjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdprhgtphhtthhopehrshhgsggplhhfpghgrhhouhhpsegslhgrtghkshhhvggvphdrohhrghenucevlhhushhtvghrufhiiigvpedt X-Xfinity-VMeta: sc=0;st=legit Message-ID: <8B74554DD9CC447AA7826347ACFA2369@DELL4> From: To: References: <1541712573053.31739@kuleuven.be> <1577921AD94DD17B.1915@groups.io> <1547497870081.57956@kuleuven.be> <5C3CFB7E.2010605@posteo.de> <5C3CFC32.9030509@posteo.de> <5C3E51A1.9020702@posteo.de> <5C3F2E54.1080204@posteo.de> <5C44B472.9090901@posteo.de> <1UTCP1TTXz.GTBnkuWTAJs@optiplex980-pc> <1UTCP1tymN.HCrj4Hc5Ogz@optiplex980-pc> Date: Mon, 21 Jan 2019 16:56:22 -0500 MIME-Version: 1.0 X-Priority: 3 X-MSMail-Priority: Normal X-Mailer: Microsoft Outlook Express 6.00.2900.5512 X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2900.5512 X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Riccardo Glad to hear you found the problem. Will await your announcement and look for your signal tomorrow night. Jay W1VD ----- Original Message ----- From: Riccardo Zoli To: LF Group Sent: Monday, January 21, 2019 4:13 PM Subject: Re: LF: EbNaut tonite Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:33 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: ae3221d431bd19e5880aa98eda07ece4 Subject: Re: LF: EbNaut tonite Content-Type: multipart/alternative; boundary="----=_NextPart_000_0252_01D4B1AA.3CD53770" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: *** X-Spam-Status: No, hits=3.4 required=5.0 tests=FORGED_MUA_OUTLOOK,HTML_40_50, HTML_MESSAGE,MAILTO_TO_SPAM_ADDR,NO_REAL_NAME autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format. ------=_NextPart_000_0252_01D4B1AA.3CD53770 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Riccardo Glad to hear you found the problem. Will await your announcement and = look for your signal tomorrow night. Jay W1VD ----- Original Message -----=20 From: Riccardo Zoli=20 To: LF Group=20 Sent: Monday, January 21, 2019 4:13 PM Subject: Re: LF: EbNaut tonite Jay, Rob, Markus, Stefan, Joe, LF Jay, thanks again for the decode: congrats for your rx setup. And thank you so much for trying, Rob. Here, the TP2 reference signal (not sufficiently filtered) overshot = sometimes the quadrature divider (x4) causing that phase jumps. The = problem is now fixed. A new TX EbNaut session is scheduled for starting tomorrow evening. All the best 73 de Riccardo IW4DXW Il giorno Lun 21 Gen 2019, 13:20 jrusgrove@comcast.net = ha scritto: Riccardo Corrected decode: 0300 Rank 0 car Eb/N0 2.3 Eb/N0 1.4 FBDECODE Jay W1VD ----- Original Message ----- From: Reply-To: To: Sent: 1/21/2019 6:53:39 AM Subject: Re: LF: EbNaut tonite -------------------------------------------------------------------------= - Stefan, Riccardo & EbNaut-eers Stefan ... good copy throughout the night. Riccardo ... = unfortunately only one decode to report. Markus noted a frequency error = ... curious if propagation or NE0-M8T?=20 137545 2200 Rank 0 car Eb/N0 9.5 Eb/N0 9.2 RADIO GAGA 2300 - 0000 Rank 0 car Eb/N0 9.2 Eb/N0 9.3 RADIO GAGA 0100 Rank 0 car Eb/N0 6.0 Eb/N0 6.0 RADIO GAGA 0200 Rank 0 car Eb/N0 5.3 Eb/N0 5.9 RADIO GAGA 0300 Rank 0 car Eb/N0 6.1 Eb/N0 6.8 RADIO GAGA 0400 Rank 0 car Eb/N0 11.3 Eb/N0 10.4 RADIO GAGA 0500 Rank 0 car Eb/N0 3.7 Eb/N0 4.6 RADIO GAGA 0600 Rank 0 car Eb/N0 10.6 Eb/N0 10.2 RADIO GAGA 137547 0300 Rank 0 car Eb/N0 10.0 Eb/N0 FBDECODE Jay W1VD ----- Original Message ----- From: DK7FC Reply-To: To: Sent: 1/20/2019 12:48:34 PM Subject: LF: EbNaut tonite ------------------------------------------------------------------------ LF,=20 Tonite: f =3D 137.545 kHz Start time: 20.JAN.2019 22:00:00.3 UTC (hourly, including 6 = UTC) Symbol period: 1 s Characters: 10 CRC bits: 12 Coding 16K21A Antenna current: 4 A Duration: 24:32 [mm:ss] 73, Stefan ------=_NextPart_000_0252_01D4B1AA.3CD53770 Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable =EF=BB=BF
Riccardo
 
Glad to hear you found the problem. = Will await your=20 announcement and look for your signal tomorrow night.
 
Jay W1VD
----- Original Message -----
From:=20 Riccardo Zoli
Sent: Monday, January 21, 2019 = 4:13=20 PM
Subject: Re: LF: EbNaut = tonite


Jay, Rob, Markus, Stefan, Joe, LF


Jay, thanks again for the decode: congrats for your rx = setup.
And thank you so much for trying, Rob.

Here, the TP2 reference signal (not sufficiently = filtered)=20 overshot sometimes the quadrature divider (x4) causing that phase = jumps. The=20 problem is now fixed.

A new TX EbNaut session is scheduled for starting = tomorrow=20 evening.

All the best


73 de Riccardo IW4DXW







Il giorno Lun 21 Gen 2019, 13:20 jrusgrove@comcast.net <jrusgrove@comcast.net> ha scritto:
Riccardo
 
Corrected decode:
 
0300 Rank 0 car Eb/N0 2.3 = Eb/N0 1.4 FBDECODE
 
Jay W1VD
 
 
 
----- Original Message -----
Sent: 1/21/2019 6:53:39 AM
Subject: Re: LF: EbNaut tonite
Stefan, Riccardo & EbNaut-eers
 
 
Stefan ... good copy throughout the night. Riccardo ... = unfortunately=20 only one decode to report. Markus noted a frequency error=20 ... curious if propagation or NE0-M8T?
 
 
137545
 
2200 Rank 0 car Eb/N0 9.5 Eb/N0 9.2 RADIO GAGA
2300 -
0000 Rank 0 car Eb/N0 9.2 Eb/N0 9.3 RADIO GAGA
0100 Rank 0 car Eb/N0 6.0 Eb/N0 6.0 RADIO = GAGA
0200 Rank 0 car Eb/N0 5.3 Eb/N0 5.9 RADIO = GAGA
0300 Rank 0 car Eb/N0 6.1 Eb/N0 6.8 RADIO = GAGA
0400 Rank 0 car Eb/N0 11.3 Eb/N0 10.4 RADIO = GAGA
0500 Rank 0 car Eb/N0 3.7 Eb/N0 4.6 RADIO = GAGA
0600 Rank 0 car Eb/N0 10.6 Eb/N0 10.2 RADIO = GAGA
 
 
137547
 
0300 Rank 0 car Eb/N0 10.0 = Eb/N0  FBDECODE
 
Jay W1VD
 
 
 
 
 
 
----- Original Message -----
Sent: 1/20/2019 12:48:34 PM
Subject: LF: EbNaut tonite
LF,

Tonite:

f =3D 137.545 kHz
Start time:=20 20.JAN.2019  22:00:00.3 UTC (hourly, including 6 = UTC)
Symbol=20 period: 1 s
Characters: 10
CRC bits: = 12
Coding=20 16K21A
Antenna current: 4 A
Duration: 24:32=20 [mm:ss]


73,=20 = Stefan
------=_NextPart_000_0252_01D4B1AA.3CD53770--