Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id wBKDcpI8018436 for ; Thu, 20 Dec 2018 14:38:59 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gZySE-00052f-Jm for rs_out_1@blacksheep.org; Thu, 20 Dec 2018 13:33:34 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gZySC-00052W-8g for rsgb_lf_group@blacksheep.org; Thu, 20 Dec 2018 13:33:32 +0000 Received: from resqmta-ch2-01v.sys.comcast.net ([2001:558:fe21:29:69:252:207:33]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91_59-0488984) (envelope-from ) id 1gZyS9-0008IY-KJ for rsgb_lf_group@blacksheep.org; Thu, 20 Dec 2018 13:33:31 +0000 Received: from resomta-ch2-14v.sys.comcast.net ([69.252.207.110]) by resqmta-ch2-01v.sys.comcast.net with ESMTP id ZxpygYM0VoE06ZyS5gxZ0T; Thu, 20 Dec 2018 13:33:25 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1545312805; bh=jqShuDQwYAAG6xmNH3x7YUT5sCGtIdTNkyoRZhzOCys=; h=Received:Received:Message-ID:From:To:Subject:Date:MIME-Version: Content-Type; b=b0nfT9xyT90XGeR2WcmmImkpyhYJysRvVJbkLzG9329Xq/gTsOf4SN9ZA951t8wF9 sDhOfSh/ugHoQQUvabr/CoPQAj6sZ1SHl54sFgkBvc7pARmWBMaQw2GfAVAn0YsF89 8h/BOuP3Yjfgf7acW1lsTN0FxhuHDAjzyTFDV+yjzRdXu2Kh/D4AlmBm4AJTx/7fty MQqFEb9JX3Ma4tbWLvXJjdAcy40L6YAPOG8sEcNYygogTazB6vpTQddCh5O6seroO0 dBbmbQriXzHjmtC5+7tOmzKtYgJxL/irWu1LsAGaCRycv0QdDcZn2fNotZPC9l5+39 rRI16xgv6h67w== Received: from DELL4 ([73.4.253.141]) by resomta-ch2-14v.sys.comcast.net with ESMTPA id ZyS4gauSQic2uZyS5gqWVR; Thu, 20 Dec 2018 13:33:25 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtkedrudejfedgheegucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuvehomhgtrghsthdqtfgvshhipdfqfgfvnecuuegrihhlohhuthemuceftddtnecunecujfgurhepkffhvfhfufffgggtgffrigfoqfesthejjedtuddtjeenucfhrhhomhepoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucffohhmrghinhepnhdusghughdrtghomhenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopeffgffnnfegpdhinhgvthepjeefrdegrddvheefrddugedupdhmrghilhhfrhhomhepjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdprhgtphhtthhopehrshhgsggplhhfpghgrhhouhhpsegslhgrtghkshhhvggvphdrohhrghenucevlhhushhtvghrufhiiigvpedt X-Xfinity-VMeta: sc=0;st=legit Message-ID: <7CD90104DA304D6E9345727ECB291644@DELL4> From: To: References: <6b810377-2362-44e5-5d12-e8675cf6fcc1@n1bug.com> Date: Thu, 20 Dec 2018 08:33:25 -0500 MIME-Version: 1.0 X-Priority: 3 X-MSMail-Priority: Normal X-Mailer: Microsoft Outlook Express 6.00.2900.5512 X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2900.5512 X-Spam-Score: -0.5 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: <2 cents> Maybe at the top of your EbNaut page you could list Stefan's step 0 from about a week ago. "step 0: ... Learn what is necessary to understand, knowing it means effort!" Content analysis details: (-0.5 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:33 listed in] [list.dnswl.org] 0.2 STOX_REPLY_TYPE No description available. -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: e6de17d69e46ff4ea8db042ef2cd7e46 Subject: LF: Re: EbNaut LF page updated Content-Type: text/plain; format=flowed; charset="UTF-8"; reply-type=original Content-Transfer-Encoding: 7bit X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: * X-Spam-Status: No, hits=1.9 required=5.0 tests=FORGED_MUA_OUTLOOK, NO_REAL_NAME autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false <2 cents> Maybe at the top of your EbNaut page you could list Stefan's step 0 from about a week ago. "step 0: ... Learn what is necessary to understand, knowing it means effort!" Before turning on the soldering irons it would be helpful to understand what is involved in receiving and transmitting EbNaut. In my case that meant studying Paul's website, scouring the archives of this reflector ... going back years ... for anything EbNaut, NE06M, etc related and learning functions in Spectrum Laboratory that I hadn't made use of before. Well thought out queries to the 'experts' cleared up any remaining questions. An understanding of the fundamentals involved will help all of the pieces fall into place. ----- Original Message ----- From: "N1BUG" To: Sent: Thursday, December 20, 2018 7:21 AM Subject: LF: EbNaut LF page updated >I found some time this morning to update my new EbNaut LF page. Now > includes links to IZ7SLZ and EA5DOM download sites. Also added a bit > of explanatory text. > > Please tell me about any errors. > > This is a work in progress. I am probably missing some links which > should be included. I will always welcome new information and > suggestions! > > http://www.n1bug.com/lfmf/ebnaut/index.shtml > > 73, > Paul > >