Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id x0GMXuuI005397 for ; Wed, 16 Jan 2019 23:33:57 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gjtd4-0002iK-B9 for rs_out_1@blacksheep.org; Wed, 16 Jan 2019 22:25:46 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gjtZh-0002hV-Ka for rsgb_lf_group@blacksheep.org; Wed, 16 Jan 2019 22:22:17 +0000 Received: from resqmta-ch2-10v.sys.comcast.net ([2001:558:fe21:29:69:252:207:42]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91) (envelope-from ) id 1gjtZe-0004W4-Po for rsgb_lf_group@blacksheep.org; Wed, 16 Jan 2019 22:22:16 +0000 Received: from resomta-ch2-02v.sys.comcast.net ([69.252.207.98]) by resqmta-ch2-10v.sys.comcast.net with ESMTP id jlJ4gBZ1P1vrfjtZRgb0AU; Wed, 16 Jan 2019 22:22:01 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1547677321; bh=SnuTAw8lMFEIrm5YhH7RSzVabF3s9isFVao02rhHU4c=; h=Received:Received:Message-ID:From:To:Subject:Date:MIME-Version: Content-Type; b=U/WWA7fcW5KtT/V/d2Wi4HLjtK7lLX8Gg7iKJHekmoRNsPhw95SwTq3SXMIdZoY5u vBQb+MJT543uITcVPXQ/e4f0VVgap7Pp1004rjPZyJhxBkcKAuqXjlix0DilTN7+mE z23BADeefLgLYzfqFflYMHNX2FLeJftdRmIMesjNuhUwZ0MyexOm9hLz3WZ9JbYUnu 75pVpZyai8YYtRimBMsEaZfUYYz82m0UP+Sb+a1m6z8htuyEapmb+12DTX29g/VotO hcIY+yji1fa9qDN5+hAO/EpvcWrFBHMO1CX8lmR1kXnphlt/f8W1WV9GzyLej07i8S qhXNsBR8sb/2g== Received: from DELL4 ([73.4.253.141]) by resomta-ch2-02v.sys.comcast.net with ESMTPA id jtZPgGv0SNEfrjtZPg5d3y; Wed, 16 Jan 2019 22:22:01 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtledrgeehgdduiedvucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuvehomhgtrghsthdqtfgvshhipdfqfgfvnecuuegrihhlohhuthemuceftddtnecunecujfgurhepkffhvfhfufffgggtrfgioffqsegrtdejpedutdejnecuhfhrohhmpeeojhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvtheqnecuffhomhgrihhnpehqshhlrdhnvghtnecukfhppeejfedrgedrvdehfedrudegudenucfrrghrrghmpehhvghlohepfffgnffngedpihhnvghtpeejfedrgedrvdehfedrudeguddpmhgrihhlfhhrohhmpehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtpdhrtghpthhtoheprhhsghgspghlfhgpghhrohhuphessghlrggtkhhshhgvvghprdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-Xfinity-VMeta: sc=0;st=legit Message-ID: <7A4A5270F5BD4148AE61B50542BD9140@DELL4> From: To: References: <1541712573053.31739@kuleuven.be> <1542362144885.30626@kuleuven.be> <1542721669174.9290@kuleuven.be> <1542902405876.64977@kuleuven.be> <1544631368092.16214@kuleuven.be> <1544826336986.15705@kuleuven.be> <1545855021519.36262@kuleuven.be> <1577921AD94DD17B.1915@groups.io> <1547497870081.57956@kuleuven.be> <5C3CFB7E.2010605@posteo.de> <5C3CFC32.9030509@posteo.de> <5C3E51A1.9020702@posteo.de> <5C3F2E54.1080204@posteo.de> Date: Wed, 16 Jan 2019 17:21:59 -0500 MIME-Version: 1.0 X-Priority: 3 X-MSMail-Priority: Normal X-Mailer: Microsoft Outlook Express 6.00.2900.5512 X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2900.5512 X-Spam-Score: -0.7 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: Riccardo, Domenico Deja vu ... seems like we've been here before ... The receiver / SpecLab was set up earlier in the day to receive Stefan's transmissions on 137.545. Unfortunately, both of your announced frequencies are outside the passband in the current setup ... w [...] Content analysis details: (-0.7 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:42 listed in] [list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: 6c6c9ebb44f1581e4b632ca4327fde2e Subject: Re: LF: Re: EbNaut tonite Content-Type: multipart/alternative; boundary="----=_NextPart_000_0186_01D4ADBF.FD0A3390" X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: *** X-Spam-Status: No, hits=3.1 required=5.0 tests=FORGED_MUA_OUTLOOK,HTML_60_70, HTML_MESSAGE,HTML_TAG_EXISTS_TBODY,MAILTO_TO_SPAM_ADDR,NO_REAL_NAME autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false This is a multi-part message in MIME format. ------=_NextPart_000_0186_01D4ADBF.FD0A3390 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Riccardo, Domenico Deja vu ... seems like we've been here before ... The receiver / SpecLab was set up earlier in the day to receive Stefan's = transmissions on 137.545. Unfortunately, both of your announced = frequencies are outside the passband in the current setup ... which is = approximately +/- 3 Hz. In the future it would be best if you could stay = within 3 Hz. Think Marcus advocated for 1 Hz separation in the past.=20 Will be happy to look for your EbNaut signals another night. Jay W1VD ----- Original Message -----=20 From: Riccardo Zoli=20 To: LF Group=20 Sent: Wednesday, January 16, 2019 3:52 PM Subject: Re: LF: Re: EbNaut tonite Hi LF & EbNauters. Ok, Stefan and Domenico: I'll join you with the same transmission = coding and parameters on 137.535 kHz (message repeated hourly, 1st on = 2100z, last on 0700z). Reports are welcome. All the best 73 de Riccardo IW4DXW Il giorno Mer 16 Gen 2019, 21:03 Domenico IZ7SLZ = ha scritto: LF, I will transmit a 4 character message with EbNaut on 137.540 kHz, = sym=3D8s, code=3D4K19A, CRC=3D16. Transmissions will start on 2019-01-16 22.00 UTC with a duration of = 30' 56''; then repeated every hour. Last transmission on 2019-01-17 = 06:00. TX setup in use: Paul N. Program 'EbSynth' steered with 10 kHz from = GPS, analog SSB exciter with reference oscillator steered by the same = GPS, 'gpds' and 'chrony' programs for controlling the UTC time of the = computer. Antenna current =3D 1.5 A, antenna type rev-L 8+8 meters. Reports are welcome. 73, Domenico IZ7SLZ / JN80nu =20 On Wed, 16 Jan 2019 at 15:57, Domenico IZ7SLZ = wrote: Hello Stefan and LF, results of decoding for your EbNaut signal in JN80nu are at = https://qsl.net/iz7slz/EBNAUT/DECODED.TXT Attached to this email there is a folder with the plots of the = eight periods. First two transmissions seems to be affected by fading. I want to join your EbNaut session tonight with some transmissions = from my side. I will announce the parameters as soon the setup is ready. 73, Domenico IZ7SLZ On Wed, 16 Jan 2019 at 14:20, DK7FC = wrote: Hello Rob and Jay,=20 Many thanks for the reports and all the details. Jay, did you = miss the 22 UTC transmission or did it not decode? Interesting to see the phase plots. It is expected that the = phase is less stable when the band opens. In the last transmission, the = Eb/N0 is not high enough to see the phase pattern. I wonder if the traces become more evident if 4K19 is used. What happens when a solar event happens during the transmission = time? Does it change the phase or just the D layer attenuation? Maybe we can repeat the experiment, using 4K19A. Of course a = carrier could be used too, but i like to 'play' with EbNaut. So, tonite: f =3D 137.545 kHz Start time: 16.JAN.2019 22:00:00.3 UTC Symbol period: 8 s Characters: 4 CRC bits: 16 Coding 4K19A Antenna current: 4 A Duration: 30:56 [mm:ss] 73, Stefan Am 16.01.2019 12:29, schrieb Rob Renoud:=20 Stefan, Late start but 7 successful decodes. Have not gotten to phase = plots yet... UTC Rank C Eb/N0 Eb/N0 MSG Ref Phase=20 0100 0 5.6 1.6 2019 0,-30,0 30=20 0200 0 6.9 0.4 2019 60,30 30 0=20 0300 0 9.9 5.8 2019 90,60,60,0=20 0400 0 11.2 8.8 2019 180,180,150,150=20 0500 0 6.3 2.7 2019 0,-30,-30,-60=20 73, Rob =E2=80=93 K3RWR From: DK7FC=20 Sent: Tuesday, January 15, 2019 9:33 PM To: rsgb_lf_group@blacksheep.org=20 Subject: Re: LF: Re: EbNaut tonite LF,=20 Today, the messages will be transmitted as announced, starting = 22 UTC 73, Stefan Am 14.01.2019 22:16, schrieb DK7FC:=20 PS: Repeatinh hourly, until including 6 UTC. Am 14.01.2019 22:13, schrieb DK7FC:=20 Hi LF,=20 Just a short EbNaut message tonite. I'm interested to see = the phase changes on a long path. Markus's showrawsyms does a good job = there, as long as 8K19A is used. A shorter message should also help to = build up a clear trace. So let's try an unusual short message: f =3D 137.545 kHz Start time: 14.JAN.2019 22:00:00.3 UTC Symbol period: 4 s Characters: 4 CRC bits: 16 Coding 8K19A Antenna current: 4 A Duration: 30:56 [mm:ss] Reports, including phase plots, welcome :-) 73, Stefan ------=_NextPart_000_0186_01D4ADBF.FD0A3390 Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable =EF=BB=BF
Riccardo, Domenico
 
Deja vu ... seems like we've been here = before=20 ...
 
The receiver / SpecLab was set up = earlier in the=20 day to receive Stefan's transmissions on=20 137.545. Unfortunately, both of your announced frequencies are = outside=20 the passband in the current setup ... which is approximately +/- 3 = Hz. In=20 the future it would be best if you could stay within 3 = Hz. Think=20 Marcus advocated for 1 Hz separation in the past. 
 
Will be happy to look for your EbNaut = signals=20 another night.
 
Jay W1VD
----- Original Message -----
From:=20 Riccardo Zoli
Sent: Wednesday, January 16, = 2019 3:52=20 PM
Subject: Re: LF: Re: EbNaut = tonite


Hi LF & EbNauters.

Ok, Stefan and Domenico: I'll join you with the same=20 transmission coding and parameters on 137.535 = kHz (message=20 repeated hourly, 1st on 2100z, last on 0700z).

Reports are welcome.

All the best


73 de Riccardo IW4DXW




Il giorno Mer 16 Gen 2019, 21:03 Domenico IZ7SLZ <iz7slz.domenico@gmail.com> ha = scritto:
LF,

I will transmit a 4 character message with EbNaut on = 137.540=20 kHz, sym=3D8s, code=3D4K19A, = CRC=3D16.
Transmissions will start on 2019-01-16 22.00 UTC with a = duration of 30'=20 56''; then repeated every hour. Last transmission on 2019-01-17 = 06:00.

TX setup in use: Paul N. Program 'EbSynth' steered with 10 kHz = from=20 GPS, analog SSB exciter with reference oscillator steered by the = same GPS,=20 'gpds' and 'chrony' programs for controlling the UTC time of the=20 computer.
Antenna current =3D 1.5 A, antenna type rev-L 8+8 meters.

Reports are welcome.

73, Domenico IZ7SLZ / JN80nu







On=20 Wed, 16 Jan 2019 at 15:57, Domenico IZ7SLZ <iz7slz.domenico@gmail.com>=20 wrote:
Hello Stefan and LF,

results of decoding for your EbNaut signal in JN80nu are at = https://qsl.net/iz7slz/EBNAUT/DECODED.TXT

Attached to this email there is a folder with the plots of = the eight=20 periods. First two transmissions seems to be affected by = fading.

I want to join your EbNaut session tonight with some = transmissions=20 from my side. I will announce the parameters as soon the setup is=20 ready.

73, Domenico IZ7SLZ




On Wed, 16 Jan 2019 at 14:20, DK7FC <selberdenken@posteo.de>=20 wrote:
Hello Rob and Jay,

Many thanks = for the=20 reports and all the details. Jay, did you miss the 22 UTC = transmission=20 or did it not decode?
Interesting to see the phase plots. It = is=20 expected that the phase is less stable when the band opens. In = the last=20 transmission, the Eb/N0 is not high enough to see the phase=20 pattern.
I wonder if the traces become more evident if 4K19 = is=20 used.

What happens when a solar event happens during the=20 transmission time? Does it change the phase or just the D layer=20 attenuation?
Maybe we can repeat the experiment, using 4K19A. = Of=20 course a carrier could be used too, but i like to 'play' with=20 EbNaut.

So, tonite:

f =3D 137.545 kHz
Start = time:=20 16.JAN.2019  22:00:00.3 UTC
Symbol period: 8 = s
Characters:=20 4
CRC bits: 16
Coding 4K19A
Antenna current: = 4=20 A
Duration: 30:56 [mm:ss]


 73,=20 Stefan


Am 16.01.2019 12:29, schrieb Rob Renoud:=20
Stefan,
 
Late start but 7 successful decodes.  Have not = gotten to=20 phase plots yet...
 
UTC Rank C=20 Eb/N0 Eb/N0 MSG Ref=20 Phase0100 0 5.6 1.6 2019 0,-30,0=20 300200 0 6.9 0.4 2019 60,30 30=20 00300 0 9.9 5.8 2019 90,60,60,00400 0 11.2 8.8 2019 180,180,150,1500500 0 6.3 2.7 2019 0,-30,-30,-60
 
73,
Rob =E2=80=93 = K3RWR
 
 
From: DK7FC
Sent: Tuesday, January 15, 2019 9:33 PM
Subject: Re: LF: Re: EbNaut = tonite
 
LF,=20

Today, the messages will be transmitted as announced, = starting=20 22 UTC

73, Stefan

Am 14.01.2019 22:16, schrieb = DK7FC:=20
PS: Repeatinh hourly, until = including 6=20 UTC.

Am 14.01.2019 22:13, schrieb DK7FC:=20
Hi LF,

Just a short EbNaut = message=20 tonite. I'm interested to see the phase changes on a long = path.=20 Markus's showrawsyms does a good job there, as long as = 8K19A is=20 used. A shorter message should also help to build up a = clear=20 trace.
So let's try an unusual short = message:

f =3D=20 137.545 kHz
Start time: 14.JAN.2019  22:00:00.3=20 UTC
Symbol period: 4 s
Characters: 4
CRC = bits:=20 16
Coding 8K19A
Antenna current: 4 = A
Duration:=20 30:56 [mm:ss]

Reports, including phase plots, = welcome=20 :-)

73,=20 = Stefan

------=_NextPart_000_0186_01D4ADBF.FD0A3390--