Return-Path: Received: from post.thorcom.com (post.thorcom.com [195.171.43.25]) by klubnl.pl (8.14.4/8.14.4/Debian-8+deb8u2) with ESMTP id wBJGJHRC012012 for ; Wed, 19 Dec 2018 17:19:23 +0100 Received: from majordom by post.thorcom.com with local (Exim 4.14) id 1gZeLx-0007kf-4c for rs_out_1@blacksheep.org; Wed, 19 Dec 2018 16:05:45 +0000 Received: from [195.171.43.32] (helo=relay1.thorcom.net) by post.thorcom.com with esmtp (Exim 4.14) id 1gZeLw-0007kW-AC for rsgb_lf_group@blacksheep.org; Wed, 19 Dec 2018 16:05:44 +0000 Received: from resqmta-ch2-03v.sys.comcast.net ([2001:558:fe21:29:69:252:207:35]) by relay1.thorcom.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.91_59-0488984) (envelope-from ) id 1gZeLu-00063O-FO for rsgb_lf_group@blacksheep.org; Wed, 19 Dec 2018 16:05:43 +0000 Received: from resomta-ch2-10v.sys.comcast.net ([69.252.207.106]) by resqmta-ch2-03v.sys.comcast.net with ESMTP id Zd9AgGgOlpVLRZeLpg2mpv; Wed, 19 Dec 2018 16:05:37 +0000 X-DKIM-Result: Domain=comcast.net Result=Signature OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=q20161114; t=1545235537; bh=UumYTBiG8hnmDwTzCFREu6SfrWNkXpEw0Ns+XyWPdUA=; h=Received:Received:Message-ID:From:To:Subject:Date:MIME-Version: Content-Type; b=JOuixM8fLkgcBYfLS1sA1YTkV3pPK1xh0lLuMLuYwijiQzQx6BMKYXQj6Nd3tMFnV 5od/wopReevJ9X/CozDB+uYPjuESI2wpkJXnWVeTVRIBFWcHrNLV+1enRXm1ARyiky m6VeSStwCPHtldssbQDcbghtpgNyVGpTgJLONHS313/PHyD98DrZ1Os7YzU9jI5ayb c1Mc0OGcx0MMxLtGebT2pIUeDVdoAGX+AOVVKNiWHPmjf1iZzILFTG78g/vMB9FCw8 71ARuTgkjb/z/D8JcNrjoHHUYfs75EM16bI3vi/XtMSggA2HL1rc/tuvTj0YrLj556 jN/y4+664G/ew== Received: from DELL4 ([73.4.253.141]) by resomta-ch2-10v.sys.comcast.net with ESMTPA id ZeLmgHrwkMv5DZeLngvWTE; Wed, 19 Dec 2018 16:05:36 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedtkedrudejtddgkeegucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuvehomhgtrghsthdqtfgvshhipdfqfgfvnecuuegrihhlohhuthemuceftddtnecunecujfgurhepkffhvfhfufffgggtgffrigfoqfesthejjedtuddtjeenucfhrhhomhepoehjrhhushhgrhhovhgvsegtohhmtggrshhtrdhnvghtqeenucfkphepjeefrdegrddvheefrddugedunecurfgrrhgrmhephhgvlhhopeffgffnnfegpdhinhgvthepjeefrdegrddvheefrddugedupdhmrghilhhfrhhomhepjhhruhhsghhrohhvvgestghomhgtrghsthdrnhgvthdprhgtphhtthhopehrshhgsggplhhfpghgrhhouhhpsegslhgrtghkshhhvggvphdrohhrghenucevlhhushhtvghrufhiiigvpedt X-Xfinity-VMeta: sc=0;st=legit Message-ID: <589042FBC49042C1BC9B6E9BC667F079@DELL4> From: To: References: <10f465fa-37f0-4ac6-b53d-793f955ea011@email.android.com> <5C19FFCB.1060305@posteo.de> <16876196-3308-f722-dfca-5232150e7394@n1bug.com> <5C1A3F32.9070604@posteo.de> Date: Wed, 19 Dec 2018 11:05:34 -0500 MIME-Version: 1.0 X-Priority: 3 X-MSMail-Priority: Normal X-Mailer: Microsoft Outlook Express 6.00.2900.5512 X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2900.5512 X-Spam-Score: -0.5 (/) X-Spam-Report: Spam detection software, running on the system "relay1.thorcom.net", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: >Yes, a band filter in front of the mixer and then an image rejection >filter on the AF side. Thus it is better to use an LO frequency of 125 >or 120 kHz rather than 135 kHz because filtering will be [...] Content analysis details: (-0.5 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [2001:558:fe21:29:69:252:207:35 listed in] [list.dnswl.org] 0.2 STOX_REPLY_TYPE No description available. -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (jrusgrove[at]comcast.net) 0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid X-Scan-Signature: ac0f6ff1af52b6036ac1f4fe0c2bd52c Subject: Re: LF: Ebnaut receiver frequency stability qustion Content-Type: text/plain; format=flowed; charset="UTF-8"; reply-type=original Content-Transfer-Encoding: 7bit X-Spam-Checker-Version: SpamAssassin 2.63 (2004-01-11) on post.thorcom.com X-Spam-Level: * X-Spam-Status: No, hits=1.9 required=5.0 tests=FORGED_MUA_OUTLOOK, NO_REAL_NAME autolearn=no version=2.63 X-SA-Exim-Scanned: Yes Sender: owner-rsgb_lf_group@blacksheep.org Precedence: bulk Reply-To: rsgb_lf_group@blacksheep.org X-Listname: rsgb_lf_group X-SA-Exim-Rcpt-To: rs_out_1@blacksheep.org X-SA-Exim-Scanned: No; SAEximRunCond expanded to false >Yes, a band filter in front of the mixer and then an image rejection >filter on the AF side. Thus it is better to use an LO frequency of 125 >or 120 kHz rather than 135 kHz because filtering will be easier then. The image rejection filter needs to be ahead of the mixer ... otherwise noise (and possibly signals) at 113 kHz will appear as part of the i-f signal at 12 kHz. Jay W1VD ----- Original Message ----- From: "DK7FC" To: Sent: Wednesday, December 19, 2018 7:53 AM Subject: Re: LF: Ebnaut receiver frequency stability qustion > Hi Paul, > > Am 19.12.2018 13:00, schrieb N1BUG: >> Hi Stefan, Luis, LF, >> >> Yes, yes! Please grab some paper and start drawing those circuit >> diagrams! ;-) >> > No problem. I've drawn the circuit years ago. But the design (based on a > G4JNT design) is a bit more complex. But there you don't need image > rejection filters, which is an advantage. Image in the attachment. > This is what i use for LF transmissions. The xtal is GPS locked by > another circuit that is not shown in this schematic. But instead one can > use the NEO GPS modules. Not only EbNaut, the converter is good for > WSPR, QRSS, DFCW, OP32, JT9 and so on. > >> What kind of mixer? >> > For the RX i'm using an SBL-3 DBM. But a SA612AN will work too ( i use > that one for the MF converter). There, you will need narrow band filters. > >> Can filters help? Band pass filter on antenna input to mixer? LPF on >> LO to mixer? >> > Yes, a band filter in front of the mixer and then an image rejection > filter on the AF side. Thus it is better to use an LO frequency of 125 > or 120 kHz rather than 135 kHz because filtering will be easier then. >> Probably more questions but since I am not an engineer and have >> never seen a diagram of this, I don't know what else to ask. >> >> Can the same LO and mixer be used for a tx up-converter? >> > I'm using the same LO for the RX and then TX converter. > > 73, Stefan >